Property Summary

NCBI Gene PubMed Count 17
PubMed Score 36.88
PubTator Score 197.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.300 7.3e-04
medulloblastoma, large-cell -1.400 1.5e-05
posterior fossa group B ependymoma 1.200 4.4e-09

Gene RIF (8)

AA Sequence

MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPELLLLALGALGW      1 - 70
TALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLLFGTDYPFFHDPPSVFYDWTP     71 - 140
GMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVMLLHHVVTLILIVSSYAFRYHNVGILVLFLHD    141 - 210
ISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPF    211 - 280
YFFFNALLLLLTLMNLYWFLYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF    281 - 350
//

Text Mined References (19)

PMID Year Title