Property Summary

NCBI Gene PubMed Count 143
Grant Count 334
R01 Count 229
Funding $35,438,663.41
PubMed Score 243.26
PubTator Score 314.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
psoriasis -1.500 0.001
osteosarcoma -3.011 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.006
ovarian cancer -1.700 0.000

Synonym

Accession P27540 B2R9H1 C4AMA1 F8WAP6 Q59ED4 Q5QP39 Q8NDC7 ARNT protein
Symbols HIF1B
TANGO
bHLHe2
HIF1BETA
HIF-1beta
HIF1-beta
HIF-1-beta

Gene

PDB

2A24   3F1N   3F1O   3F1P   3H7W   3H82   4GHI   4GS9   4PKY   4XT2   5T0T   1D7G   1X0O   2ARN   2B02   2HV1   2K7S   4EQ1   4H6J   4LPZ   5TBM  

Gene RIF (97)

PMID Text
26572229 The results of this study indicate that ARNT depletion renders tumour cells susceptible to radiation whereas overexpression of this transcription factor confers radioresistance
26469385 HIV-1 MA downregulates ARNT gene expression in HepG2 cells
26388611 HIF-1beta might act as a novel cross-link between the HIF and NF-kappaB pathways in suppression of angiogenesis by LDL, while proteasome inhibitors might promote angiogenesis by reactivating this signaling cascade under hyperlipidemia.
26101050 ARNT Val189Val polymorphism is not associated with endometriosis in Asians.
25904334 HIF1 regulates claudin-1 in intestinal epithelium. This regulation is important for intestinal epithelial tight junction integrity.
25839165 Down-regulation of ARNT promotes colorectal cancer metastasis by activating the fibronectin/integrin beta1/FAK axis.
25769544 AhR/ARNT activation and overexpression of BCL6 are collectively responsible for differential expression of more than 100 genes in diffuse large B-cell lymphoma cell line.
25627682 findings suggest that TACC3 could be recruited as a bridge to cooperatively mediate between the HIF-2alpha PAS-B.ARNT PAS-B complex, thereby participating more directly in HIF-dependent gene transcription than previously anticipated
25343232 ARNT expression in the placental vasculature mediates key angiogenic expression and fetoplacental endothalial cell angiogenesis, and low ARNT expression in FGRadv ECs appears to be a key factor in deficient angiogenesis.
25201625 Arnt suppressed CXCL8, but did not prevent the p65-activation directly.
More...

AA Sequence

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND      1 - 70
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK     71 - 140
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY    141 - 210
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN    211 - 280
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN    281 - 350
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG    351 - 420
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANL    421 - 490
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEI    491 - 560
YHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSN    561 - 630
PTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR    631 - 700
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQS    701 - 770
NSYNNEEFPDLTMFPPFSE                                                       771 - 789
//

Text Mined References (150)

PMID Year Title
26572229 2015 The expression level of the transcription factor Aryl hydrocarbon receptor nuclear translocator (ARNT) determines cellular survival after radiation treatment.
26388611 2015 LDL suppresses angiogenesis through disruption of the HIF pathway via NF-?B inhibition which is reversed by the proteasome inhibitor BSc2118.
26101050 2015 Meta-analysis of the association of AhR Arg554Lys, AhRR Pro185Ala, and ARNT Val189Val polymorphisms and endometriosis risk in Asians.
25904334 2015 HIF-dependent regulation of claudin-1 is central to intestinal epithelial tight junction integrity.
25839165 2015 Down-regulation of ARNT promotes cancer metastasis by activating the fibronectin/integrin ?1/FAK axis.
25769544 2015 BCL6--regulated by AhR/ARNT and wild-type MEF2B--drives expression of germinal center markers MYBL1 and LMO2.
25627682 2015 Coiled-coil coactivators play a structural role mediating interactions in hypoxia-inducible factor heterodimerization.
25343232 2015 Impaired fetoplacental angiogenesis in growth-restricted fetuses with abnormal umbilical artery doppler velocimetry is mediated by aryl hydrocarbon receptor nuclear translocator (ARNT).
25201625 2014 AhR and Arnt differentially regulate NF-?B signaling and chemokine responses in human bronchial epithelial cells.
25068796 2014 Silencing of hypoxia-inducible factor-1? induces anti-tumor effects in hepatoma cell lines under tumor hypoxia.
More...