Property Summary

NCBI Gene PubMed Count 156
PubMed Score 261.21
PubTator Score 314.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 9.7e-07
glioblastoma 1.100 2.6e-04
intraductal papillary-mucinous adenoma (... 1.100 5.8e-03
malignant mesothelioma -1.800 5.7e-07
medulloblastoma, large-cell 1.400 7.1e-06
osteosarcoma 1.301 1.7e-03
ovarian cancer -1.100 2.9e-08
psoriasis -1.500 8.7e-04

Protein-protein Interaction (3)

Gene RIF (107)

AA Sequence

MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND      1 - 70
KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK     71 - 140
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY    141 - 210
DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN    211 - 280
RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN    281 - 350
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG    351 - 420
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANL    421 - 490
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEI    491 - 560
YHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSN    561 - 630
PTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR    631 - 700
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQS    701 - 770
NSYNNEEFPDLTMFPPFSE                                                       771 - 789
//

Text Mined References (164)

PMID Year Title