Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.74
PubTator Score 424.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 3.5e-10
cutaneous lupus erythematosus 1.300 4.7e-02
esophageal adenocarcinoma -4.000 2.2e-02
non-small cell lung cancer 3.665 2.0e-10
psoriasis 1.300 7.1e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (5)

AA Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL      1 - 70
GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE     71 - 140
EFVRVLVSK                                                                 141 - 149
//

Text Mined References (24)

PMID Year Title