Property Summary

NCBI Gene PubMed Count 22
Grant Count 3
Funding $179,274.75
PubMed Score 6.19
PubTator Score 424.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma -4.000 0.022
psoriasis 2.100 0.000
cutaneous lupus erythematosus 1.300 0.047
non-small cell lung cancer 3.665 0.000
Breast cancer -1.700 0.000

Gene RIF (5)

PMID Text
23638045 Increased CALML3 expression in suprabasal layers is characteristic for differentiating keratinocytes in normal epidermis, and nuclear expression of CALML3 inversely correlates with expression of the proliferation marker Ki-67.
19166543 expression was readily detected in areas of normal oral mucosa, while a notable downregulation of expression occurred in areas of malignant transformation
18818677 increased CLP expression and CLP-mediated Myo10 function are important for skin differentiation and wound reepithelialization
17130134 CLP may be required during terminal differentiation to increase myosin-10 function as cells migrate toward the upper layers and establish new adhesive contacts.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL      1 - 70
GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE     71 - 140
EFVRVLVSK                                                                 141 - 149
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23638045 2013 Immunolocalization of the tumor-sensitive calmodulin-like protein CALML3 in normal human skin and hyperproliferative skin disorders.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19166543 2009 Human calmodulin-like protein (CLP) expression in oral squamous mucosa and in malignant transformation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18818677 2009 Calmodulin-like protein upregulates myosin-10 in human keratinocytes and is regulated during epidermal wound healing in vivo.
18570893 2008 Interaction with the IQ3 motif of myosin-10 is required for calmodulin-like protein-dependent filopodial extension.
18295593 2008 Calmodulin-like protein enhances myosin-10 translation.
17130134 2007 Calmodulin-like protein increases filopodia-dependent cell motility via up-regulation of myosin-10.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...