Property Summary

NCBI Gene PubMed Count 22
PubMed Score 47.94
PubTator Score 34.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.91632365962816E-13
malignant mesothelioma 3163 8.82994926508819E-10
non-small cell lung cancer 2798 9.89483285707796E-10
chronic lymphosyte leukemia 232 5.4643427830265E-9
lung cancer 4473 1.68657974278631E-6
invasive ductal carcinoma 2950 2.92654824987106E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.01663504354513E-5
ulcerative colitis 2087 1.03041523891994E-4
ductal carcinoma in situ 1745 1.78937399894341E-4
Duchenne muscular dystrophy 602 3.17626417764753E-4
cystic fibrosis 1670 4.85253840926139E-4
lung adenocarcinoma 2714 6.52250959583124E-4
hepatocellular carcinoma 550 7.12949623368963E-4
psoriasis 6685 0.00103412311712165
sonic hedgehog group medulloblastoma 1482 0.00117883075113837
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00119167286634464
breast carcinoma 1614 0.00121319110853065
colon cancer 1475 0.00131668834672554
Atopic dermatitis 944 0.00443467431056579
ovarian cancer 8492 0.00620889874616775
glioblastoma 5572 0.00814571170522479
tuberculosis 1563 0.00882816064702315
mucosa-associated lymphoid tissue lymphoma 480 0.00931615842743416
aldosterone-producing adenoma 664 0.0157583781709915
fibroadenoma 557 0.0211473676128573
non primary Sjogren syndrome sicca 840 0.023597653385362
adrenocortical carcinoma 1427 0.0254507234181145
gastric cancer 436 0.0310791909981409
cutaneous lupus erythematosus 1056 0.0364301231145163

Expression

Synonym

Accession P27469 Q6FGC8
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (16)

PMID Text
26318046 Data indicate that a tumor suppressor mechanism by which G0/G1 switch gene 2 product (G0S2) directly inhibits activity of a key intracellular adipose triglyceride lipase (ATGL).
25588877 Results indicate that G0S2 acts as a prosurvival molecule in endothelial cells.
25258314 Data indicate that the peptide corresponding to residues Lys-20 to Ala-52 from G0S2 Inhibits ATGL in the nanomolar range.
24183236 A new mechanism that controls proliferation in K562 cells, suggesting a possible tumor suppressor function for G0S2 in leukemia cells.
23951308 reelin expression is altered by Abeta leading to impaired reelin signaling.
23546556 This linked G0S2 subcellular localization to G0S2 transcriptional repression. The potential mechanisms responsible for this G0S2 repression are examined.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of G0/G1switch 2 (G0S2) in peptide-treated PBMCs
22891293 Data indicate that downregulation of G0S2 in adipose tissue could represent one of the underlying causes leading to increased lipolysis in the insulin-resistant state.
22716248 Gene expression profiles showed that G0/G1 switch 2 was up-regulated in epidermolysis bullosa subtypes.
22535977 Reduced mRNA and protein content of Plin and G0S2 and borderline increased ATGL protein in sc adipose tissue from poorly controlled type 2 diabetic subjects.
More...

AA Sequence

METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL      1 - 70
ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS                                          71 - 103
//

Text Mined References (22)

PMID Year Title
26318046 2015 Inhibition of adipose triglyceride lipase (ATGL) by the putative tumor suppressor G0S2 or a small molecule inhibitor attenuates the growth of cancer cells.
25588877 2015 Lipolytic inhibitor G0/G1 switch gene 2 inhibits reactive oxygen species production and apoptosis in endothelial cells.
25258314 2014 A peptide derived from G0/G1 switch gene 2 acts as noncompetitive inhibitor of adipose triglyceride lipase.
24183236 2014 G0S2 inhibits the proliferation of K562 cells by interacting with nucleolin in the cytosol.
23951308 2013 The g0/g1 switch gene 2 is an important regulator of hepatic triglyceride metabolism.
23546556 2013 Repression of exogenous gene expression by the retinoic acid target gene G0S2.
22891293 2012 G0/G1 switch gene-2 regulates human adipocyte lipolysis by affecting activity and localization of adipose triglyceride lipase.
22716248 2012 Epidermolysis bullosa - a group of skin diseases with different causes but commonalities in gene expression.
22535977 2012 Reduced mRNA and protein expression of perilipin A and G0/G1 switch gene 2 (G0S2) in human adipose tissue in poorly controlled type 2 diabetes.
21613358 2011 Fasting, but not exercise, increases adipose triglyceride lipase (ATGL) protein and reduces G(0)/G(1) switch gene 2 (G0S2) protein and mRNA content in human adipose tissue.
More...