Property Summary

NCBI Gene PubMed Count 22
Grant Count 16
R01 Count 10
Funding $1,077,786.91
PubMed Score 47.94
PubTator Score 34.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26318046 Data indicate that a tumor suppressor mechanism by which G0/G1 switch gene 2 product (G0S2) directly inhibits activity of a key intracellular adipose triglyceride lipase (ATGL).
25588877 Results indicate that G0S2 acts as a prosurvival molecule in endothelial cells.
25258314 Data indicate that the peptide corresponding to residues Lys-20 to Ala-52 from G0S2 Inhibits ATGL in the nanomolar range.
24183236 A new mechanism that controls proliferation in K562 cells, suggesting a possible tumor suppressor function for G0S2 in leukemia cells.
23951308 reelin expression is altered by Abeta leading to impaired reelin signaling.
23546556 This linked G0S2 subcellular localization to G0S2 transcriptional repression. The potential mechanisms responsible for this G0S2 repression are examined.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of G0/G1switch 2 (G0S2) in peptide-treated PBMCs
22891293 Data indicate that downregulation of G0S2 in adipose tissue could represent one of the underlying causes leading to increased lipolysis in the insulin-resistant state.
22716248 Gene expression profiles showed that G0/G1 switch 2 was up-regulated in epidermolysis bullosa subtypes.
22535977 Reduced mRNA and protein content of Plin and G0S2 and borderline increased ATGL protein in sc adipose tissue from poorly controlled type 2 diabetic subjects.
More...

AA Sequence

METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL      1 - 70
ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS                                          71 - 103
//

Text Mined References (22)

PMID Year Title
26318046 2015 Inhibition of adipose triglyceride lipase (ATGL) by the putative tumor suppressor G0S2 or a small molecule inhibitor attenuates the growth of cancer cells.
25588877 2015 Lipolytic inhibitor G0/G1 switch gene 2 inhibits reactive oxygen species production and apoptosis in endothelial cells.
25258314 2014 A peptide derived from G0/G1 switch gene 2 acts as noncompetitive inhibitor of adipose triglyceride lipase.
24183236 2014 G0S2 inhibits the proliferation of K562 cells by interacting with nucleolin in the cytosol.
23951308 2013 The g0/g1 switch gene 2 is an important regulator of hepatic triglyceride metabolism.
23546556 2013 Repression of exogenous gene expression by the retinoic acid target gene G0S2.
22891293 2012 G0/G1 switch gene-2 regulates human adipocyte lipolysis by affecting activity and localization of adipose triglyceride lipase.
22716248 2012 Epidermolysis bullosa - a group of skin diseases with different causes but commonalities in gene expression.
22535977 2012 Reduced mRNA and protein expression of perilipin A and G0/G1 switch gene 2 (G0S2) in human adipose tissue in poorly controlled type 2 diabetes.
21613358 2011 Fasting, but not exercise, increases adipose triglyceride lipase (ATGL) protein and reduces G(0)/G(1) switch gene 2 (G0S2) protein and mRNA content in human adipose tissue.
More...