Property Summary

NCBI Gene PubMed Count 45
PubMed Score 78.88
PubTator Score 21.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteopetrosis 43 3.022 1.5

Expression

Protein-protein Interaction (6)

Gene RIF (14)

AA Sequence

MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL      1 - 70
VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV     71 - 140
LGLYGLIVALILSTK                                                           141 - 155
//

Text Mined References (47)

PMID Year Title