Property Summary

NCBI Gene PubMed Count 45
Grant Count 6
R01 Count 6
Funding $1,342,589
PubMed Score 72.64
PubTator Score 21.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Osteopetrosis 40 3.046 1.5

Expression

Gene RIF (14)

PMID Text
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
24695574 A role for ATP6V0C in maintaining constitutive and stress-induced ALP function.
24385903 siRNA knockdown of ATP6V0C resulted in almost complete loss of infectious virus production, suggesting that an human cytomegalovirus microRNA targets a crucial cellular factor required for virus replication.
24254321 The consequences of pharmacological inhibition of v-ATPase (by concanamycin) on proliferation, migration, VEGF-receptor 2 (VEGFR2) trafficking and signaling, as well as Notch-mediated transcription in endothelial cells, were examined.
24166050 Results show that inhibition of V-ATPase by archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo.
22991218 results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase
22829766 data suggest that the bacterial effector VepA targets subunit c of V-ATPase and induces the rupture of host cell lysosomes and subsequent cell death.
21433058 ATP6L has a protective role against SNP-induced autophagic cell death via inhibition of JNK and p38 in GSH-depleted glial cells.
21087195 Novel recessive myoclonic epilepsy candidate gene myoclonic epilepsy , but no mutation was found.
19875448 HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells.
More...

AA Sequence

MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL      1 - 70
VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV     71 - 140
LGLYGLIVALILSTK                                                           141 - 155
//

Text Mined References (47)

PMID Year Title
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24695574 2014 ATP6V0C knockdown in neuroblastoma cells alters autophagy-lysosome pathway function and metabolism of proteins that accumulate in neurodegenerative disease.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24385903 2013 Systematic microRNA analysis identifies ATP6V0C as an essential host factor for human cytomegalovirus replication.
24254321 2014 Regulation of endothelial signaling and migration by v-ATPase.
24166050 2014 V-ATPase inhibition by archazolid leads to lysosomal dysfunction resulting in impaired cathepsin B activation in vivo.
22991218 2013 A novel tumor metastasis suppressor gene LASS2/TMSG1 interacts with vacuolar ATPase through its homeodomain.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
More...