Property Summary

NCBI Gene PubMed Count 41
Grant Count 14
Funding $1,033,951.01
PubMed Score 277.62
PubTator Score 230.03

Knowledge Summary

Patent (4,384)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 1.400 0.000
osteosarcoma -1.258 0.000
ovarian cancer -1.700 0.000

 GWAS Trait (1)

Gene RIF (14)

PMID Text
25028520 findings indicate that brain PP-1I associates with and is regulated by the associated protein kinases C-TAK1 and PFTK1
23894155 We have shown that serum ALP levels modified the association of MARK3 with bone mineral density in osetoporosis for Chinese patients.
20554715 Observational study of gene-disease association. (HuGE Navigator)
20534768 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20214879 interaction between Mitf and C-TAK1 was demonstrated.
19079262 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17726107 identify a molecular mechanism through which the hMARK3 UBA domain has evolved to bind the kinase domain
17672918 occurrence of an unusual TG 3' splice site in intron 3
16980613 Class IIa histone deacetylases (HDACs) are subjected to signal-independent nuclear export that relies on their constitutive phosphorylation. EMK and C-TAK1, are identified as regulators of this process.
16968750 14-3-3 binding to MARK3 is dependent on phosphorylation.
More...

AA Sequence

MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKV      1 - 70
KLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEV     71 - 140
FDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLD    141 - 210
TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDC    211 - 280
ENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLS    281 - 350
KMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVFSSQKQRRYSD    351 - 420
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSS    421 - 490
TVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTA    491 - 560
SRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYE    561 - 630
RNGRYEGSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFC    631 - 700
VHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL                     701 - 753
//

Text Mined References (54)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25028520 2014 Regulation of protein phosphatase 1I by Cdc25C-associated kinase 1 (C-TAK1) and PFTAIRE protein kinase.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23894155 2013 Genetic analysis of recently identified osteoporosis susceptibility genes in southern Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145462 2010 Kinase associated-1 domains drive MARK/PAR1 kinases to membrane targets by binding acidic phospholipids.
20554715 2010 Analysis of recently identified osteoporosis susceptibility genes in Han Chinese women.
More...