Property Summary

Ligand Count 27
NCBI Gene PubMed Count 1,066
PubMed Score 3483.98
PubTator Score 1169.27

Knowledge Summary

Patent (100,118)

TINX Plot

  Disease (4)

Expression

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (1036)

AA Sequence

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI      1 - 70
KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSN     71 - 140
DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY    141 - 210
RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNY    211 - 280
LQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAM    281 - 350
ELDDLPKERLKELIFQETARFQPGVLEAP                                             351 - 379
//

Text Mined References (1097)

PMID Year Title