Property Summary

NCBI Gene PubMed Count 981
PubMed Score 3186.79
PubTator Score 1169.27

Knowledge Summary

Patent (100,118)

Expression

Synonym

Accession P27361 A8CZ58 B0LPG3 Q8NHX1 MAP kinase 3
Symbols ERK1
ERT2
ERK-1
PRKM3
P44ERK1
P44MAPK
HS44KDAP
HUMKER1A
p44-ERK1
p44-MAPK

Gene

PDB

2ZOQ   4QTB  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
602295 confirmatory 1 / 0 / 198 MLPCN Dyrk1A - ERK1 Selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-07_Inhibitor_Dose_CherryPick_Activity_Set2
602348 confirmatory 1 / 0 / 198 MLPCN Dyrk1A - ERK1 Selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-07_Inhibitor_Dose_CherryPick_Activity
651659 confirmatory 1 / 0 / 44 MLPCN Dyrk1A - ERK1 Selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-07_Inhibitor_Dose_DryPowder_Activity_Set2

Gene RIF (955)

PMID Text
27098723 the purpose of this paper was to investigate MAPK downstream signalling molecules in Natural killer cell phenotypes from Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26945151 The Asian-American variant of human papillomavirus type 16 exhibits higher activation of MAPK and PI3K/AKT signaling pathways, transformation, migration and invasion of primary human keratinocytes.
26930065 Studies indicate key feedback loops involved in the cross-talk among the insulin-proto-oncogene protein c-akt (AKT) and MAPK/ERK signaling pathways.
26867010 FXa inhibitor reduces the collagen-stimulated release of phosphorylated HSP27 from human platelets due to the inhibition of HSP27 phosphorylation via p44/p42 MAP kinase
26858456 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26823699 Oleanolic acid suppresses the proliferation of human bladder cancer by targeting Akt/mTOR/S6K and ERK1/2 signaling.
26795953 The results showed that PDGF-BB significantly increased PRMT1 expression after 1h lasting over 48h, through ERK1/2 MAPK and STAT1 signaling.
26767647 ERK1-ERK2 pathway plays a crucial role in cancer cell survival and proliferation and therefore represents an attractive target for anticancer therapy. (Review)
26742423 In summary, this study identified a novel role for EGFRvIII in hypoxia tolerance, supporting an important link between hypoxia and subcellular localization alterations of the receptor.
26617770 MicroRNA-133b inhibits proliferation and invasion of ovarian cancer cells by inactivating Akt and Erk1/2 signaling and targeting EGFR.
More...

AA Sequence

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI      1 - 70
KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSN     71 - 140
DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY    141 - 210
RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNY    211 - 280
LQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAM    281 - 350
ELDDLPKERLKELIFQETARFQPGVLEAP                                             351 - 379
//

Text Mined References (1012)

PMID Year Title
27098723 2016 ERK1/2, MEK1/2 and p38 downstream signalling molecules impaired in CD56 dim CD16+ and CD56 bright CD16 dim/- natural killer cells in Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26945151 2016 The Asian-American variant of human papillomavirus type 16 exhibits higher activation of MAPK and PI3K/AKT signaling pathways, transformation, migration and invasion of primary human keratinocytes.
26930065 2016 Dynamic Modeling and Analysis of the Cross-Talk between Insulin/AKT and MAPK/ERK Signaling Pathways.
26867010 2016 Factor Xa Inhibitor Suppresses the Release of Phosphorylated HSP27 from Collagen-Stimulated Human Platelets: Inhibition of HSP27 Phosphorylation via p44/p42 MAP Kinase.
26858456 2016 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26823699 2015 Oleanolic acid suppresses the proliferation of human bladder cancer by Akt/mTOR/S6K and ERK1/2 signaling.
26795953 2016 PDGF-BB induces PRMT1 expression through ERK1/2 dependent STAT1 activation and regulates remodeling in primary human lung fibroblasts.
26767647 2016 Extracellular signal-regulated kinase 1 and 2 in cancer therapy: a focus on hepatocellular carcinoma.
26742423 2016 Nuclear EGFRvIII resists hypoxic microenvironment induced apoptosis via recruiting ERK1/2 nuclear translocation.
26617770 2015 MicroRNA-133b inhibits proliferation and invasion of ovarian cancer cells through Akt and Erk1/2 inactivation by targeting epidermal growth factor receptor.
More...