Property Summary

NCBI Gene PubMed Count 178
Grant Count 116
R01 Count 60
Funding $20,565,901.36
PubMed Score 217.43
PubTator Score 508.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession P27348 D6W4Z5 Q567U5 Q5TZU8 Q9UP48
Symbols 1C5
HS1
14-3-3

Gene

PANTHER Protein Class (1)

PDB

2BTP   5IQP  

 GO Function (1)

Gene RIF (92)

PMID Text
26832367 Levels of 14-3-3 protein predict poorer radiographic outcomes in inflammatory polyarthritis patients.
26231887 Study shows that 14-3-3 zeta/delta is important in the extracellular vesicles mediated induction of colon malignant phenotype, suggesting its role as a potential target for therapeutic interventions.
26054824 the effects of cell viability, migration and invasion were mediated in 14-3-3zeta-dependent manner while that of cell apoptosis was mediated in 14-3-3zeta-independent manner.
26033570 Mimitin and 14-3-3 protein zeta/delta are potential markers of paclitaxel resistance and prognostic factors in ovarian cancer.
25723543 phosphorylation of HS1 tyrosines at positions 222, 378 and 397 was required for transendothelial migration of NK cells.
25448011 14-3-3S is an interesting protein biomarker with the potential to further improve the accuracy of differential diagnostic process of hepatocellular tumors.
25305692 The observed participation of 14-3-3 tau in the regulation of the placental epigenome may participate in the molecular mechanisms that govern the pathological process of preeclampsia, although this requires further evaluation.
25169136 14-3-3zeta reduces DNA damage by interacting with and stabilizing proliferating cell nuclear antigen
25041782 Epigenetic silencing of 14-3-3sigma occurred more frequently in the chronic inflammation group than in cancer patients and healthy controls.
24681339 14-3-3s not only can bind and regulate the activity of multiple phosphoproteins, but also possess moonlighting chaperone-like activity
More...

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTD      1 - 70
TSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQ     71 - 140
TIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDS    141 - 210
YKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN                                       211 - 245
//

Text Mined References (190)

PMID Year Title
26832367 2016 Serum levels of 14-3-3? protein supplement C-reactive protein and rheumatoid arthritis-associated antibodies to predict clinical and radiographic outcomes in a prospective cohort of patients with recent-onset inflammatory polyarthritis.
26231887 2015 Extracellular vesicle-mediated phenotype switching in malignant and non-malignant colon cells.
26054824 2015 Tanshinone IIA inhibits the proliferation, migration and invasion of ectopic endometrial stromal cells of adenomyosis via 14-3-3? downregulation.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
26033570 2015 Quantitative proteomic analysis of mitochondria from human ovarian cancer cells and their paclitaxel-resistant sublines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25723543 2015 Role of cortactin homolog HS1 in transendothelial migration of natural killer cells.
25448011 2015 A structured proteomic approach identifies 14-3-3Sigma as a novel and reliable protein biomarker in panel based differential diagnostics of liver tumors.
25416956 2014 A proteome-scale map of the human interactome network.
More...