Property Summary

Ligand Count 1
NCBI Gene PubMed Count 192
PubMed Score 235.41
PubTator Score 508.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.601 1.3e-07
autosomal dominant Emery-Dreifuss muscul... 1.001 4.7e-03
dermatomyositis 1.800 1.1e-03
Duchenne muscular dystrophy 1.261 6.7e-09
fascioscapulohumeral muscular dystrophy 1.063 5.1e-04
juvenile dermatomyositis 1.339 2.7e-11
lung cancer 1.300 2.7e-03
Multiple myeloma 2.032 5.6e-04
osteosarcoma 1.334 1.3e-05
ovarian cancer -1.500 2.2e-03
psoriasis 1.100 1.7e-04
Waldenstrons macroglobulinemia 1.248 2.9e-02

Gene RIF (94)

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTD      1 - 70
TSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQ     71 - 140
TIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDS    141 - 210
YKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN                                       211 - 245
//

Text Mined References (204)

PMID Year Title