Property Summary

NCBI Gene PubMed Count 153
Grant Count 136
R01 Count 69
Funding $16,953,905.16
PubMed Score 2431.71
PubTator Score 1519.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P27338 B2R6R3 B7Z5H3 D3DWC3 Q7Z6S2
Symbols

Gene

PDB

1GOS   1H8R   1OJ9   1OJA   1OJC   1OJD   1S2Q   1S2Y   1S3B   1S3E   2BK3   2BK4   2BK5   2BYB   2C64   2C65   2C66   2C67   2C70   2C72   2C73   2C75   2C76   2V5Z   2V60   2V61   2VRL   2VRM   2VZ2   2XCG   2XFN   2XFO   2XFP   2XFQ   2XFU   3PO7   3ZYX   4A79   4A7A   4CRT  

Gene RIF (142)

PMID Text
26546820 These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.
26051160 findings indicate that the low activity of monoamine oxidase gene polymorphisms has a protective effect on smoking cessation and smoking frequency.
26000819 The results of this meta-analysis suggest that people in the Asian population with the MAOB intron 13 A allele have an increased risk of Parkinson disease, especially when combined with the COMT LL genotype.
25857233 Report isolation of MOA-B inhibitors from Vernonia cinerea.
25671411 protein environment of MAO-A enhances the polar nucleophilic character of the mechanism compared to that of MAO-B
25636089 Polymorphisms of COMT and MAO-B genes has a unique characteristics among Chinese patients with Parkinson's disease. They may be related with differences in drug response in such patients.
25618115 An overall comparison between the genotype of MAOA and MAOB genes and allele frequencies of the patients and the control group did not reveal any statistically significant difference between tension headache patients and the control group.
25398695 Huntington disease neural cells exhibit increased Monoamine oxidase-A and Monoamine oxidases-B expression and activity
25389533 There is significantly decreased expression of MAO-A and MAO-B in cancerous tissues when compared with adjacent noncancerous tissues.
25220264 Data (including data from molecular dynamics simulation studies) suggest that the protonation state of the active site residue Lys296 in monoamine oxidase B does not have influence on the hydride transfer reaction in the metabolism of dopamine.
More...

AA Sequence

MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILR      1 - 70
LAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAPLA     71 - 140
EEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKF    141 - 210
VGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPM    211 - 280
MRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKAR    281 - 350
KLARLTKEERLKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR    351 - 420
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP    421 - 490
GLLRLIGLTTIFSATALGFLAHKRGLLVRV                                            491 - 520
//

Text Mined References (156)

PMID Year Title
26546820 2015 Islet-specific monoamine oxidase A and B expression depends on MafA transcriptional activity and is compromised in type 2 diabetes.
26051160 2015 Association between monoamine oxidase gene polymorphisms and smoking behavior: A meta-analysis.
26000819 2016 A meta-analysis on relationship of MAOB intron 13 polymorphisms, interactions with smoking/COMT H158L polymorphisms with the risk of PD.
25857233 2015 Inhibition effects of Vernonia cinerea active compounds against cytochrome P450 2A6 and human monoamine oxidases, possible targets for reduction of tobacco dependence.
25671411 2015 Influence of the environment on the oxidative deamination of p-substituted benzylamines in monoamine oxidase.
25636089 2015 [Polymorphisms of catechol-O-methyltransferase and monoamine oxidase B genes among Chinese patients with Parkinson's disease].
25618115 Association analysis of the functional MAOA gene promoter and MAOB gene intron 13 polymorphisms in tension type headache patients.
25398695 2015 Inhibition of Excessive Monoamine Oxidase A/B Activity Protects Against Stress-induced Neuronal Death in Huntington Disease.
25389533 2014 The influence of monoamine oxidase variants on the risk of betel quid-associated oral and pharyngeal cancer.
25220264 2014 Empirical valence bond simulations of the hydride transfer step in the monoamine oxidase B catalyzed metabolism of dopamine.
More...