Property Summary

Ligand Count 1,061
NCBI Gene PubMed Count 163
PubMed Score 2530.35
PubTator Score 1519.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (19)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 6.0e-05
atypical teratoid / rhabdoid tumor -2.700 2.0e-07
Breast cancer -1.900 2.3e-03
breast carcinoma -1.700 5.7e-03
chronic rhinosinusitis -2.016 1.4e-03
colon cancer -2.800 4.6e-08
cystic fibrosis and chronic rhinosinusit... -1.681 1.4e-02
ependymoma 1.300 2.0e-05
group 3 medulloblastoma -2.300 2.8e-05
head and neck cancer -1.100 6.3e-03
invasive ductal carcinoma -3.100 1.0e-02
lung adenocarcinoma -1.100 7.1e-07
lung cancer 1.200 5.9e-04
medulloblastoma, large-cell -2.100 2.8e-04
non-small cell lung cancer -2.068 1.6e-17
ovarian cancer -2.700 1.1e-07
pancreatic ductal adenocarcinoma liver m... -1.560 6.2e-03
pituitary cancer 1.700 1.9e-06
psoriasis 1.400 2.2e-03

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (152)

AA Sequence

MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILR      1 - 70
LAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAPLA     71 - 140
EEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKF    141 - 210
VGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPM    211 - 280
MRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKAR    281 - 350
KLARLTKEERLKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR    351 - 420
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP    421 - 490
GLLRLIGLTTIFSATALGFLAHKRGLLVRV                                            491 - 520
//

Text Mined References (166)

PMID Year Title