Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.57
PubTator Score 52.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.7e-22
colon cancer 1478 2.9e-02
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.1
substance-related disorder 162 0.0 0.7
Disease Target Count Z-score Confidence
Trichorhinophalangeal syndrome type II 15 3.952 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -1.600 2.9e-02
psoriasis -1.900 3.7e-22

Gene RIF (4)

AA Sequence

MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS      1 - 70
ELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDV     71 - 140
KGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQ    141 - 210
AYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDL    211 - 280
QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH                                      281 - 316
//

Text Mined References (21)

PMID Year Title