Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.86
PubTator Score 52.63

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 3.73067468595673E-22
colon cancer 1475 0.0289024514269878
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Disease Target Count Z-score Confidence
Trichorhinophalangeal syndrome type II 14 4.032 2.0


  Differential Expression (2)

Disease log2 FC p
colon cancer -1.600 0.029
psoriasis -1.900 0.000


Accession P27216 Q9BQR5
Symbols ISA


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

26110394 High ANXA13 expression is associated with Refractory Lupus Nephritis.
20701074 Ectopic overexpression of Annexin A13 was likewise sufficient to sensitize malignant breast cancer cells to treatment with Rapamycin.
11961095 The unique, conserved aspects of annexin A13 primary structure, gene organization, and genetic maps identify it as the probable common ancestor of all vertebrate annexins.

AA Sequence

QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH                                      281 - 316

Text Mined References (20)

PMID Year Title
26110394 2015 Biomarkers for Refractory Lupus Nephritis: A Microarray Study of Kidney Tissue.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21184583 2011 Genome-wide association study of theta band event-related oscillations identifies serotonin receptor gene HTR7 influencing risk of alcohol dependence.
20701074 2010 Identification of annexin A13 as a regulator of chemotherapy resistance using random homozygous gene perturbation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.