Property Summary

NCBI Gene PubMed Count 1,045
PubMed Score 2648.76
PubTator Score 2476.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Atherosclerosis 291 6.215 3.1
Coronary artery disease 268 5.498 2.7
diabetes mellitus 1728 4.701 2.4
Hyperhomocysteinemia 37 3.787 1.9
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Acute coronary syndrome 39 0.0 0.0
Agricultural Workers' Diseases 1 0.0 0.0
Amyotrophic lateral sclerosis 451 0.0 0.0
Arteritis 3 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Birth Weight 13 0.0 0.0
Brain Neoplasms 33 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholestasis 155 0.0 0.0
Constipation 181 0.0 0.0
Coronary Disease 25 0.0 0.0
Coronary Vasospasm 3 0.0 0.0
Depressive disorder 409 0.0 0.0
Diabetes Complications 6 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Diabetic retinopathy 56 0.0 0.0
Fatty Liver 70 0.0 0.0
Glomerulonephritis, Membranoproliferative 6 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart failure 162 0.0 0.0
Hematologic Neoplasms 22 0.0 0.0
Hemorrhoids 13 0.0 0.0
Hypercholesterolemia 44 0.0 0.0
Hyperlipoproteinemia Type II 12 0.0 0.0
Hyperlipoproteinemias 5 0.0 0.0
Hyperthyroidism 53 0.0 0.0
Infertility, Male 46 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lymphoma 81 0.0 0.0
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 5 1 0.0 0.0
Metabolic Diseases 10 0.0 0.0
Metabolic Syndrome 20 0.0 0.0
Micronuclei, Chromosome-Defective 25 0.0 0.0
Neuroectodermal Tumors, Primitive 8 0.0 0.0
Neurotoxicity Syndromes 26 0.0 0.0
Occupational Diseases 12 0.0 0.0
Organophosphate poisoning 4 0.0 0.0
Parkinson Disease, Secondary 9 0.0 0.0
Periodontal Diseases 21 0.0 0.0
Persian Gulf Syndrome 2 0.0 0.0
Prenatal Exposure Delayed Effects 11 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Spinal Dysraphism 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -2.568 1.9e-05
lung cancer 2.200 1.5e-03
lung carcinoma 3.000 2.0e-22
pancreatic ductal adenocarcinoma liver m... -3.558 1.4e-02

Protein-protein Interaction (5)

Gene RIF (1181)

AA Sequence

MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLK      1 - 70
YPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKST     71 - 140
VELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLQSWEMYLGLAWSYVVYYSP    141 - 210
SEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDL    211 - 280
WVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA    281 - 350
LYCEL                                                                     351 - 355
//

Text Mined References (1051)

PMID Year Title