Property Summary

NCBI Gene PubMed Count 973
Grant Count 295
R01 Count 122
Funding $58,104,047.37
PubMed Score 2495.31
PubTator Score 2476.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -2.568 0.000
pancreatic ductal adenocarcinoma liver m... -3.558 0.014
lung cancer 2.200 0.001
lung carcinoma 3.000 0.000

Synonym

Accession P27169 B2RA40 Q16052 Q6B0J6 Q9UCB1 PON 1
Symbols ESA
PON
MVCD5

Gene

PDB

1V04   1XHR  

Gene RIF (1109)

PMID Text
27166546 PON1 Q192R polymorphism is likely to be a risk factor for cataract development in Pakistani population while PON1 L55M was not found to be associated with cataract.
27085770 Data suggest that serum PON1 activity is up-regulated in subjects treated with cholesterol-lowering agents (fibrates with/without statins) in prevention of cardiovascular disease (CVD) in patients at risk for CVD. [META-ANALYSIS, REVIEW]
26870959 PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents.
26829396 Molecular dynamics simulation studies were employed on selected recombinant h-PON1 (rh-PON1) mutants to understand the effect of amino acid substitutions at position 192 on the structural features of the active site of the enzyme.
26773776 genetic association study in population of women in Brazil: Data suggest an SNP in promoter of PON1 [T(-107)C, rs705379] is associated with variations in serum PON1 activity; PON1 is higher with CC genotype; high-fat diet down-regulates PON1 activity.
26769660 Data from Bavarian population suggest serum PON1 (paraoxonase 1) activity is lowest in non-drinkers and highest in people who consume 15-30 g of alcohol/d; serum AE (arylesterase) activity increases with alcohol consumption; associations are weak.
26654051 hPON1 were found to reduce various virulence factors including pyocyanin, rhamnolipid, elastase, staphylolytic LasA protease and alkaline protease in Pseudomonas aeruginosa.
26632904 SIGNIFICANT ASSOCIATIONS WITH CHRONIC HEPATITIS B RISK WERE observed for PON1 rs705382 SNP after adjusting for sex, age, ethnicity, smoking, alcohol consumption, and body mass index IN Chinese POPULATIONS
26567339 Leu-9, Tyr-185, and Tyr-293 of PON1 are importance in binding to HDL and catalytic activity.
26254371 The aim of the present study was to investigate the association between Paraoxonase 1 (PON1) gene polymorphisms Q192R, and L55M in patients with Chronic Myelogenous Leukemia (CML) and Chronic Lymphocytic Leukemia (CLL) patients.
More...

AA Sequence

MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLK      1 - 70
YPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKST     71 - 140
VELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLQSWEMYLGLAWSYVVYYSP    141 - 210
SEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDL    211 - 280
WVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA    281 - 350
LYCEL                                                                     351 - 355
//

Text Mined References (979)

PMID Year Title
27166546 2016 Q192R paraoxonase1 polymorphism is a risk factor for cataract in Pakistani population.
27085770 2016 Systematic review and meta-analysis deciphering the impact of fibrates on paraoxonase-1 status.
26870959 2016 Association of PON1, P2Y12 and COX1 with Recurrent Ischemic Events in Patients with Extracranial or Intracranial Stenting.
26829396 2016 Toward Understanding the Catalytic Mechanism of Human Paraoxonase 1: Site-Specific Mutagenesis at Position 192.
26773776 2016 The effect of the paraoxonase 1 (PON1) T(-107)C polymorphism on serum PON1 activity in women is dependent on fatty acid intake.
26769660 2016 Association between alcohol consumption and serum paraoxonase and arylesterase activities: a cross-sectional study within the Bavarian population.
26654051 2016 Inhibition of quorum sensing-controlled virulence factors in Pseudomonas aeruginosa by human serum paraoxonase.
26632904 2015 Association of Paraoxonase 1 Gene Polymorphisms With the Risk of Hepatitis B Virus-related Liver Diseases in a Guangxi Population: A Case-control Study.
26567339 2016 Identification of Critical Paraoxonase 1 Residues Involved in High Density Lipoprotein Interaction.
26254371 2015 Q192R and L55M Polymorphisms of Paraoxonase 1 Gene in Chronic Myelogenous Leukemia and Chronic Lymphocytic Leukemia.
More...