Property Summary

NCBI Gene PubMed Count 20
PubMed Score 64.89
PubTator Score 18.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis -1.455 0.010
malignant mesothelioma -3.400 0.000
astrocytic glioma -1.500 0.006
ependymoma -2.000 0.037
oligodendroglioma -1.500 0.020
osteosarcoma 2.330 0.001
group 4 medulloblastoma -2.800 0.000
atypical teratoid/rhabdoid tumor -1.400 0.001
glioblastoma -1.100 0.025
medulloblastoma, large-cell -1.800 0.009
primitive neuroectodermal tumor -1.800 0.000
adrenocortical carcinoma 2.923 0.001
primary pancreatic ductal adenocarcinoma 1.591 0.007
tuberculosis -1.800 0.000
non-small cell lung cancer 2.722 0.000
intraductal papillary-mucinous adenoma (... 2.300 0.005
Hydrolethalus syndrome 2.077 0.022
lung cancer 2.500 0.000
pancreatic cancer 2.100 0.000
interstitial cystitis -1.100 0.008
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma 1.333 0.030
invasive ductal carcinoma -2.200 0.045
Pick disease 1.500 0.000
Breast cancer -1.200 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P27144 B2R927 D3DQ62 Q6IBH4 Q6NXQ5 Q8IUU9 AK 4
Symbols AK3
AK 4
AK3L1
AK3L2

Gene

AK4

PANTHER Protein Class (3)

PDB

2AR7   2BBW   3NDP  

Gene RIF (6)

PMID Text
26980435 Results found that AK4 was involved in hypoxia tolerance, resistance to anti-tumor drug, and the regulation of mitochondrial activity.
23474458 a stress-protective function of AK4
23002211 Data indicate that patients with high adenylate kinase-4 (AK4) and low transcription factor ATF3 expression showed unfavorable outcomes compared with patients with low AK4 and high ATF3 expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19766732 The AK4 cDNA was expressed in Escherichia coli and the substrate specificity and kinetic properties of the recombinant protein were characterized.
19073142 To investigate the role of hinge IV, crystal structure of human adenylate kinase 4 (AK4) L171P mutant was determined.

AA Sequence

MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVIT      1 - 70
RLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDF     71 - 140
NPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLF    141 - 210
SNKITPIQSKEAY                                                             211 - 223
//

Text Mined References (25)

PMID Year Title
26980435 2016 Modulation of anti-cancer drug sensitivity through the regulation of mitochondrial activity by adenylate kinase 4.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23474458 2013 Differential expression of adenylate kinase 4 in the context of disparate stress response strategies of HEK293 and HepG2 cells.
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23002211 2012 Adenylate kinase-4 is a marker of poor clinical outcomes that promotes metastasis of lung cancer by downregulating the transcription factor ATF3.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...