Property Summary

NCBI Gene PubMed Count 20
PubMed Score 66.54
PubTator Score 18.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.552 2.7e-03
astrocytic glioma -1.500 5.7e-03
Astrocytoma, Pilocytic -1.300 4.1e-04
atypical teratoid / rhabdoid tumor -1.300 7.5e-03
Breast cancer -1.100 7.9e-03
ependymoma -2.000 3.7e-02
glioblastoma -1.100 2.5e-02
group 3 medulloblastoma -1.400 1.7e-03
Hydrolethalus syndrome 1.679 3.9e-02
interstitial cystitis -1.100 8.5e-03
intraductal papillary-mucinous adenoma (... 1.600 6.4e-03
invasive ductal carcinoma -1.570 3.4e-05
lung cancer 2.500 2.1e-05
malignant mesothelioma -3.400 1.1e-08
medulloblastoma, large-cell -1.800 9.0e-03
nephrosclerosis -1.455 1.0e-02
non-small cell lung cancer 1.616 1.9e-18
oligodendroglioma -1.500 2.0e-02
osteosarcoma 2.069 2.5e-04
ovarian cancer -1.300 1.1e-02
pancreatic cancer 1.300 3.3e-05
Pick disease 1.500 5.7e-05
primary pancreatic ductal adenocarcinoma 1.591 6.6e-03
primitive neuroectodermal tumor -1.800 1.1e-05
subependymal giant cell astrocytoma 1.333 3.0e-02
tuberculosis -1.800 1.3e-04

Gene RIF (6)

AA Sequence

MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVIT      1 - 70
RLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDF     71 - 140
NPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLF    141 - 210
SNKITPIQSKEAY                                                             211 - 223
//

Text Mined References (25)

PMID Year Title