Property Summary

NCBI Gene PubMed Count 59
PubMed Score 176.90
PubTator Score 55.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.482 2.8e-02
acute quadriplegic myopathy 1.302 7.9e-05
colon cancer -1.300 4.8e-04
cystic fibrosis -1.049 3.5e-05
dermatomyositis 1.200 7.4e-03
Down syndrome 1.700 1.3e-03
gastric carcinoma 1.200 1.5e-02
group 4 medulloblastoma -1.200 1.3e-04
juvenile dermatomyositis 1.142 5.8e-11
lung adenocarcinoma -1.100 2.1e-04
lung cancer -1.100 3.7e-03
lung carcinoma -1.800 2.1e-26
malignant mesothelioma -7.100 3.1e-08
mucosa-associated lymphoid tissue lympho... 1.123 5.5e-03
Multiple myeloma 1.445 4.9e-03
non-small cell lung cancer -1.313 2.1e-24
osteosarcoma -1.092 5.6e-03
ovarian cancer -2.100 9.3e-06
pancreatic cancer 1.200 1.2e-02
pancreatic ductal adenocarcinoma liver m... -2.268 4.1e-03
primitive neuroectodermal tumor -1.200 2.7e-02
subependymal giant cell astrocytoma 1.109 4.9e-02
tuberculosis 1.100 6.5e-05
ulcerative colitis 2.000 1.5e-04

Gene RIF (20)

AA Sequence

MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR      1 - 70
ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD     71 - 140
SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE    141 - 210
AEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII    211 - 280
GAKHSHLG                                                                  281 - 288
//

Text Mined References (65)

PMID Year Title