Property Summary

NCBI Gene PubMed Count 56
Grant Count 27
R01 Count 27
Funding $3,500,319.33
PubMed Score 186.33
PubTator Score 55.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.634 0.009
malignant mesothelioma -7.300 0.000
osteosarcoma -2.280 0.000
cystic fibrosis -1.049 0.000
primitive neuroectodermal tumor -1.400 0.006
juvenile dermatomyositis 1.142 0.000
acute quadriplegic myopathy 1.501 0.000
tuberculosis 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.268 0.004
non-small cell lung cancer -1.313 0.000
lung cancer -3.800 0.000
colon cancer -1.500 0.001
active Crohn's disease 1.567 0.029
group 4 medulloblastoma -1.200 0.000
subependymal giant cell astrocytoma 1.109 0.049
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.800 0.000
gastric carcinoma 1.200 0.015
mucosa-associated lymphoid tissue lympho... 1.123 0.005
ulcerative colitis 2.000 0.000
ovarian cancer -2.100 0.000
Down syndrome 1.700 0.001
pancreatic cancer 1.400 0.002
dermatomyositis 1.200 0.007

 GO Function (1)

Gene RIF (17)

PMID Text
25262680 Authors took a proteomic approach to identify stomatin, a member of the integral proteins of lipid rafts, as a cellular protein interacting with hepatitis C virus NS5B.
24533441 Stomatin protein expression is down-regulated in 80% of non-small cell lung cancer samples.
23672602 upregulation of stomatin by hypoxia and dex may enhance the barrier function of alveolar epithelia and mediate the adaptive role of glucocorticoid to hypoxia
23219802 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains
21501885 [review] Stomatin family member STOM is oligomeric; it localizes mostly to membrane domains and has been shown to modulate ion channel activity.
20858460 The study indicates that stomatin, sorcin, and synexin are echinophilic membrane components that mainly locate outside GM1 rafts in the human erythrocyte membrane.
20583170 Observational study of gene-disease association. (HuGE Navigator)
19696025 Stomatin-like protein-1 interacts with stomatin and is targeted to late endosomes
18267007 Stomatin is a member of an ancient protein family that has extremely well conserved homologues in all three domains of life.
18067507 Data indicate that a stomatin-specific, raft-based process is involved in storage-associated vesiculation.
More...

AA Sequence

MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR      1 - 70
ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD     71 - 140
SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE    141 - 210
AEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII    211 - 280
GAKHSHLG                                                                  281 - 288
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25262680 2014 Interaction of stomatin with hepatitis C virus RNA polymerase stabilizes the viral RNA replicase complexes on detergent-resistant membranes.
24533441 2014 Simultaneous expression of flotillin-1, flotillin-2, stomatin and caveolin-1 in non-small cell lung cancer and soft tissue sarcomas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23672602 2013 Up-regulation of stomatin expression by hypoxia and glucocorticoid stabilizes membrane-associated actin in alveolar epithelial cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23219802 2013 Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...