Property Summary

Ligand Count 2
NCBI Gene PubMed Count 95
PubMed Score 108.02
PubTator Score 76.03

Knowledge Summary

Patent (21,545)

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -2.100 2.7e-02
adult high grade glioma -1.600 1.3e-04
astrocytic glioma -1.400 1.7e-02
Astrocytoma, Pilocytic -1.100 1.2e-04
atypical teratoid / rhabdoid tumor -2.200 3.6e-04
Breast cancer -1.300 5.4e-13
breast carcinoma -1.100 4.7e-18
ependymoma -1.200 2.6e-04
glioblastoma -1.700 1.9e-04
interstitial cystitis -1.300 4.4e-04
invasive ductal carcinoma -1.700 1.2e-03
osteosarcoma -2.825 2.8e-05
ovarian cancer -1.700 3.1e-08
ulcerative colitis -1.300 1.5e-05

Gene RIF (40)

AA Sequence

MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS      1 - 70
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNIL     71 - 140
LYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQ    141 - 210
LLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLK    211 - 280
ANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG    281 - 350
KSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG    351 - 420
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIIT    421 - 490
TEDIVTVVTMVTNVDFPPKESSL                                                   491 - 513
//

Text Mined References (98)

PMID Year Title