Property Summary

NCBI Gene PubMed Count 93
Grant Count 93
R01 Count 47
Funding $6,920,216.47
PubMed Score 96.59
PubTator Score 76.03

Knowledge Summary

Patent (21,545)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.017
glioblastoma -1.700 0.000
osteosarcoma -2.825 0.000
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
interstitial cystitis -1.300 0.000
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
breast carcinoma -1.100 0.000
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.700 0.001
acute myeloid leukemia -2.100 0.027
ulcerative colitis -1.500 0.000
ovarian cancer 1.800 0.001

Synonym

Accession P27037 B2RAB8 B4DWQ2 D3DP85 Q53TH4 Q6NWV2 Q92474
Symbols ACVR2
ACTRII

Gene

PDB

3Q4T   3SOC   4ASX  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (38)

PMID Text
26677222 Data suggest ALK1 and ACVR2A/ACVR2B, acting as BMP9 co-receptors, rearrange pro-domains of BMP9--pro-domain dimer complex leading to displacement of pro-domains after receptor binding, release of mature non-dimer BPM9, and activation of signaling.
26086422 Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors.
26047946 Activin A inhibited signaling by BMP-6 and BMP-9 by competing for type 2 receptors ACVR2A and ACVR2B.
25659497 Data suggest that an SNP in promoter region of ACVR2A (rs1424954, the pre-eclampsia susceptibility allele) down-regulates 1) expression of ACVR2A in trophoblasts and 2) signal transduction in response to excess activin-A (as seen in pre-eclampsia).
25499008 The gene ACVR2A was associated with the more severe early onset preeclampsia.
23633461 For ACVR2A SNPs (rs10497025, rs1128919, rs13430086), no statistically significant difference was found between preeclampsia and control groups in terms of genotype and allele frequencies.
23263486 ACVR2A was identified as a subnetwork component in functional association network analysis.
22949641 ACVR2A interaction with Nodal and ADMP regulates head development from the 'organizer', a restricted group of cells in the embryo.
22848350 ACVR2A showed statistically significant differential dose-expression relationship.
22723898 This is the first report on the function of miR-195 in human placental trophoblast cells which reveals an invasion-promoting effect of the small RNA via repressing ActRIIA.
More...

AA Sequence

MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGS      1 - 70
IEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNIL     71 - 140
LYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQ    141 - 210
LLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLK    211 - 280
ANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG    281 - 350
KSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG    351 - 420
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIIT    421 - 490
TEDIVTVVTMVTNVDFPPKESSL                                                   491 - 513
//

Publication (96)

PMID Year Title
26677222 2016 Rapid Activation of Bone Morphogenic Protein 9 by Receptor-mediated Displacement of Pro-domains.
26086422 2015 Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis.
26047946 2015 Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B.
25659497 2015 ACVR2A promoter polymorphism rs1424954 in the Activin-A signaling pathway in trophoblasts.
25499008 2015 Association between ACVR2A and early-onset preeclampsia: replication study in a Northeastern Brazilian population.
23633461 2013 Polymorphisms in the activin A receptor type 2A gene affect the onset time and severity of preeclampsia in the Turkish population.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22949641 2012 Self-regulation of the head-inducing properties of the Spemann organizer.
22848350 2012 Iodine-131 dose dependent gene expression in thyroid cancers and corresponding normal tissues following the Chernobyl accident.
22723898 2012 Downregulated miR-195 detected in preeclamptic placenta affects trophoblast cell invasion via modulating ActRIIA expression.
More...