Property Summary

NCBI Gene PubMed Count 42
PubMed Score 35.76
PubTator Score 46.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.4e-62
osteosarcoma 7950 5.3e-04
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 3.0
Disease Target Count Z-score Confidence
cold-induced sweating syndrome 7 3.905 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.054 5.3e-04
psoriasis -2.100 5.4e-62

 CSPA Cell Line (3)

Gene RIF (20)

AA Sequence

MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN      1 - 70
GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT     71 - 140
FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV    141 - 210
VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV    211 - 280
AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF    281 - 350
LVSVPITLALAAAAATASSLLI                                                    351 - 372
//

Text Mined References (43)

PMID Year Title