Property Summary

NCBI Gene PubMed Count 42
Grant Count 6
R01 Count 4
Funding $206,696.98
PubMed Score 35.41
PubTator Score 46.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.054 0.001
psoriasis -2.100 0.000

 IMPC Term (1)

Gene RIF (20)

PMID Text
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24565995 The family-based study showed no association between the CNTFR rs7036351, NET rs3785143 polymorphisms, and attention-deficit hyperactivity disorder.
23398366 gene expression and surface expression in NK92 cells of ciliary neurotrophic factor alpha (CNTFR-alpha) and glycoprotein (gp)130 in natural killer (NK) cells, in the context of malaria, were investigated.
23061382 Data indicate that CNTFRalpha plays a role in the formation or maintenance of tumor-initiating cells in gliomas, is a marker that correlates with histological grade, may underlie treatment resistance in some cases, and is a potential therapeutic target.
22343487 expression of neurotrophin receptors Pan-Trk, p75 neurotrophin receptor (p75(NTR) and ciliary neurotrophic factor receptor-alpha in ulveal melanoma does not show a role in growth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219210 Data show that variants in CNTFR were significantly associated with a lower age at onset of the eating disorders.
20219210 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN      1 - 70
GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT     71 - 140
FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV    141 - 210
VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV    211 - 280
AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF    281 - 350
LVSVPITLALAAAAATASSLLI                                                    351 - 372
//

Text Mined References (43)

PMID Year Title
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24565995 2014 Family-based association study of ciliary neurotrophic factor receptor and norepinephrine transporter genes in attention-deficit hyperactivity disorder.
23398366 2013 Expression of interleukin-6 family receptors in NK92 cells is regulated by cytokines and not through direct interaction with Plasmodium falciparum-infected erythrocytes.
23061382 2012 CNTF receptor subunit ? as a marker for glioma tumor-initiating cells and tumor grade: laboratory investigation.
22343487 2012 Expression of neurotrophin receptors by retinoinvasive uveal melanoma.
21912637 2011 CNTF mediates neurotrophic factor secretion and fluid absorption in human retinal pigment epithelium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20340160 2010 Identification of ciliary neurotrophic factor receptor alpha as a mediator of neurotoxicity induced by alpha-synuclein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219210 2010 Role of the neurotrophin network in eating disorders' subphenotypes: body mass index and age at onset of the disease.
More...