Property Summary

NCBI Gene PubMed Count 69
Grant Count 43
R01 Count 29
Funding $5,876,934.88
PubMed Score 226.55
PubTator Score 177.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
tuberculosis -1.500 0.000
non-small cell lung carcinoma -1.300 0.000
interstitial cystitis 1.200 0.000
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.800 0.000
ovarian cancer -1.100 0.000

Gene RIF (48)

PMID Text
26678095 CD123 expression is associated with systemic mastocytosis.
26642704 CD96 and CD123 are expressed in bone marrow cells of patients with myelodysplastic syndromes
25957287 Our results suggest that the CD34/CD25/CD123/CD99(+) LAIP is strictly associated with FLT3-ITD-positive cells.
25906118 CD123 positivity represents a marker that can facilitate identification of the early T-cell precursor leukemia subtype, but the lack of sensitivity by immunohistochemistry limits the diagnostic utility.
25779340 Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset.
25640886 High CD123 expression is associated with systemic mastocytosis.
25406851 CD123+ plasmacytoid dendritic cells contribute to the sarcoidal granulomas associated with injected permanent fillers.
25381130 High interleukin-3 receptor alpha is associated with blastic plasmacytoid dendritic cell neoplasm.
24927407 87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression.
24846193 Increases in CD34(+)CD38(-)CD123(+) cells may reflect malignant clonal cells with aberrant differentiation, overproliferation, and decreased apoptosis in myelodysplastic syndrome, which were similar to acute myeloid leukemia.
More...

AA Sequence

MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQF      1 - 70
GAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYL     71 - 140
NVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP    141 - 210
PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYE    211 - 280
FLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQ    281 - 350
NDKLVVWEAGKAGLEECLVTEVQVVQKT                                              351 - 378
//

Text Mined References (71)

PMID Year Title
26678095 2016 CD123 immunostaining patterns in systemic mastocytosis: differential expression in disease subgroups and potential prognostic value.
26642704 2015 Expressions of CD96 and CD123 in Bone Marrow Cells of Patients with Myelodysplastic Syndromes.
25957287 2015 A Leukemia-Associated CD34/CD123/CD25/CD99+ Immunophenotype Identifies FLT3-Mutated Clones in Acute Myeloid Leukemia.
25779340 2015 Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset.
25640886 2015 Aberrant expression of CD123 (interleukin-3 receptor-?) on neoplastic mast cells.
25406851 2015 Granulomatous foreign-body reactions to permanent fillers: detection of CD123+ plasmacytoid dendritic cells.
25381130 2015 In vivo and in vitro sensitivity of blastic plasmacytoid dendritic cell neoplasm to SL-401, an interleukin-3 receptor targeted biologic agent.
24927407 2014 Distribution and levels of cell surface expression of CD33 and CD123 in acute myeloid leukemia.
24846193 2014 Increased CD34+CD38 -CD123 + cells in myelodysplastic syndrome displaying malignant features similar to those in AML.
24751333 2014 Expression of CD90, CD96, CD117, and CD123 on different hematopoietic cell populations from pediatric patients with acute myeloid leukemia.
More...