Property Summary

NCBI Gene PubMed Count 73
PubMed Score 253.01
PubTator Score 177.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.200 2.5e-04
lung adenocarcinoma -1.100 5.8e-12
lung carcinoma -1.800 7.0e-14
non-small cell lung cancer -1.227 9.3e-19
ovarian cancer -1.100 9.8e-06
tuberculosis -1.500 4.7e-04

Protein-protein Interaction (1)

Gene RIF (51)

AA Sequence

MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQF      1 - 70
GAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYL     71 - 140
NVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP    141 - 210
PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYE    211 - 280
FLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQ    281 - 350
NDKLVVWEAGKAGLEECLVTEVQVVQKT                                              351 - 378
//

Text Mined References (75)

PMID Year Title