Property Summary

NCBI Gene PubMed Count 88
Grant Count 107
R01 Count 61
Funding $18,533,142.85
PubMed Score 90.52
PubTator Score 201.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26927 A6NLA3 A8MSX3 Q13350 Q14870 Q6GTN4
Symbols MSP
HGFL
NF15S2
D3F15S2
DNF15S2

Gene

PDB

2ASU   4QT8  

Gene RIF (61)

PMID Text
26538561 Mst1 increases the acetylation of Foxp3 by inhibiting Sirt1 activity, which requires the Mst1 kinase activity.
26056943 results suggest that the decreased expression of MST1 in regulatory T cells due to hypermethylation of the promoter contributes to the pathogenesis of IgG4-related AIP
25704570 Elevated serum levels of MST1 were found in subjects with excessive alcohol use.
25551685 Identify MST1/MSP as a mitogen for tracheal basal cells.
25373346 Results suggest that Mst1 regulates proliferation of glioma cells via AKT/mTOR signaling pathway
25315688 MSP appears to promote the migration of fibroblasts, enhances collagen synthesis and remodeling, and effectively improves wound healing.
25193665 These results support the hypothesis that the alpha-chain of MSPalphabeta mediates RON dimerization.
24976283 MST1 protein gene expression is a prognostic indicator for patients diagnosed with colorectal cancer.
24881775 Hippo and Yap regulate cardiomyocyte death and regeneration.
24872389 hMOB3 modulates MST1 apoptotic signaling and supports tumor growth in glioblastoma multiforme.
More...

AA Sequence

MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFH      1 - 70
YNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPN     71 - 140
DHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGR    141 - 210
ECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATT    211 - 280
VSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGM    281 - 350
RAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR    351 - 420
NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPG    421 - 490
NSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKM    491 - 560
VCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQ    561 - 630
ECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVF    631 - 700
VDWIHKVMRLG                                                               701 - 711
//

Text Mined References (93)

PMID Year Title
26538561 2015 Mammalian Sterile 20-like Kinase 1 (Mst1) Enhances the Stability of Forkhead Box P3 (Foxp3) and the Function of Regulatory T Cells by Modulating Foxp3 Acetylation.
26056943 2015 Hypermethylation of MST1 in IgG4-related autoimmune pancreatitis and rheumatoid arthritis.
25704570 2015 Novel serum biomarkers for detection of excessive alcohol use.
25551685 2014 Cell surface marker profiling of human tracheal basal cells reveals distinct subpopulations, identifies MST1/MSP as a mitogenic signal, and identifies new biomarkers for lung squamous cell carcinomas.
25373346 2015 Mst1 regulates glioma cell proliferation via the AKT/mTOR signaling pathway.
25315688 2015 The effects of macrophage-stimulating protein on the migration, proliferation, and collagen synthesis of skin fibroblasts in vitro and in vivo.
25193665 2014 Structural basis for the binding specificity of human Recepteur d'Origine Nantais (RON) receptor tyrosine kinase to macrophage-stimulating protein.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24976283 Expression of hippo pathway in colorectal cancer.
24881775 2014 Harnessing Hippo in the heart: Hippo/Yap signaling and applications to heart regeneration and rejuvenation.
More...