Property Summary

NCBI Gene PubMed Count 15
PubMed Score 85.91
PubTator Score 25.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
group 4 medulloblastoma 1875 5.70506926380501E-4
Disease Target Count Z-score Confidence
Bruck syndrome 8 3.346 1.7
Legionnaires' disease 20 3.172 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.100 0.001

Synonym

Accession P26885 Q5BJH9 Q9BTS7 PPIase FKBP2
Symbols PPIase
FKBP-13

Gene

PANTHER Protein Class (1)

PDB

2PBC   4NNR  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12606707 FKBP13 and FK506 have roles in vesicular trafficking, influencing ADP-ribosylation factor activity through their guanine nucleotide-exchange proteins

AA Sequence

MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL      1 - 70
PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT     71 - 140
EL                                                                        141 - 142
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12606707 2003 Interaction of FK506-binding protein 13 with brefeldin A-inhibited guanine nucleotide-exchange protein 1 (BIG1): effects of FK506.
More...