Property Summary

NCBI Gene PubMed Count 16
PubMed Score 74.99
PubTator Score 25.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
group 4 medulloblastoma 1855 5.7e-04
Disease Target Count Z-score Confidence
Dacryoadenitis 10 3.057 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.100 5.7e-04

Gene RIF (4)

AA Sequence

MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL      1 - 70
PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT     71 - 140
EL                                                                        141 - 142
//

Text Mined References (19)

PMID Year Title