Property Summary

NCBI Gene PubMed Count 99
PubMed Score 1012.56
PubTator Score 587.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.206 2.3e-02
cutaneous lupus erythematosus 3.000 2.7e-03
interstitial cystitis 3.000 2.9e-03
lung adenocarcinoma 1.200 9.7e-09
Multiple myeloma -2.247 2.2e-04
non-small cell lung carcinoma 1.100 1.3e-12
osteosarcoma -2.344 2.7e-05
periodontitis 1.900 2.2e-31
psoriasis 1.200 3.3e-21
ulcerative colitis 2.100 1.6e-05

Gene RIF (80)

AA Sequence

MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS      1 - 70
FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP     71 - 140
QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF    141 - 210
LHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP                        211 - 260
//

Text Mined References (101)

PMID Year Title