Property Summary

NCBI Gene PubMed Count 91
Grant Count 216
R01 Count 75
Funding $39,234,920.78
PubMed Score 966.12
PubTator Score 587.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphosyte leukemia 1.300 0.000
Multiple myeloma -2.247 0.000
cutaneous lupus erythematosus 3.000 0.003
osteosarcoma -2.344 0.000
periodontitis 1.900 0.000
interstitial cystitis 3.000 0.003
lung adenocarcinoma 1.200 0.000
non-small cell lung carcinoma 1.100 0.000
ulcerative colitis 2.100 0.000
psoriasis 1.200 0.000

Synonym

Accession P26842 B2RDZ0
Symbols T14
S152
Tp55
TNFRSF7
S152. LPFS2

Gene

Gene RIF (73)

PMID Text
26818544 HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21.
26002513 results provide the first evidence for differential expression of CD27 among CLL prognostic groups, suggest a role for ZAP-70 dependent signaling in CD27 induction and implicate CD27 in cell-cell interactions with the lymphoid tissue microenvironment
25843314 Novel mutations in TNFRSF7/CD27 cause EBV-associated lymphoproliferative disease/hemophagocytic lymphohistiocytosis, Hodgkin lymphoma, uveitis, and recurrent infections.
25275127 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
25275127 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
25006012 NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis.
24965774 Multiple layers of memory B cells to T cell- dependent antigens describe immunoglobulin IgM+ B cells representing a memory reservoir that can re-enter the germinal center, ensuring replenishment of class-switched memory CD27+ B cells.
24841128 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
24286662 A lower primary CD24(hi) CD27(+) CD19(+) B cells may be an immunologic aspect of new-onset SLE that may be a useful tool to evaluate lupus activity and monitor the response to therapy.
24162774 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
More...

AA Sequence

MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS      1 - 70
FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP     71 - 140
QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF    141 - 210
LHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP                        211 - 260
//

Text Mined References (93)

PMID Year Title
26818544 2016 CD4+CXCR5+ T cells activate CD27+IgG+ B cells via IL-21 in patients with hepatitis C virus infection.
26002513 2015 Differential expression and function of CD27 in chronic lymphocytic leukemia cells expressing ZAP-70.
25843314 2015 Novel mutations in TNFRSF7/CD27: Clinical, immunologic, and genetic characterization of human CD27 deficiency.
25006012 2014 Sequencing-based approach identified three new susceptibility loci for psoriasis.
24965774 2014 The majority of human memory B cells recognizing RhD and tetanus resides in IgM+ B cells.
24286662 2013 Peripheral CD24hi CD27+ CD19+ B cells subset as a potential biomarker in naïve systemic lupus erythematosus.
23747721 2013 CD45RA-Foxp3(high) activated/effector regulatory T cells in the CCR7 + CD45RA-CD27 + CD28+central memory subset are decreased in peripheral blood from patients with rheumatoid arthritis.
23738704 2013 CD27+ B cells from a subgroup of common variable immunodeficiency patients are less sensitive to apoptosis rescue regardless of interleukin-21 signalling.
23677477 2013 Soluble CD27-pool in humans may contribute to T cell activation and tumor immunity.
23594958 Expansion of CD27high plasmablasts in transverse myelitis patients that utilize VH4 and JH6 genes and undergo extensive somatic hypermutation.
More...