Property Summary

NCBI Gene PubMed Count 309
PubMed Score 32.84
PubTator Score 697.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0

Expression

Gene RIF (284)

AA Sequence

MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIM      1 - 70
VAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSK     71 - 140
EDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYI    141 - 210
CMQRTV                                                                    211 - 216
//

Text Mined References (316)

PMID Year Title