Property Summary

NCBI Gene PubMed Count 44
PubMed Score 80.52
PubTator Score 19.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Creutzfeldt-Jakob Syndrome 10 0.0 0.0
Disease Target Count
Creutzfeldt-Jakob disease 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Gene RIF (33)

AA Sequence

MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEE     71 - 140
SLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQ    141 - 210
VNRLKSAQCGSSMIYHCKHKL                                                     211 - 231
//

Text Mined References (45)

PMID Year Title