Property Summary

NCBI Gene PubMed Count 41
Grant Count 29
R01 Count 12
Funding $4,338,359.23
PubMed Score 75.24
PubTator Score 19.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Creutzfeldt-Jakob disease 19

Expression

Gene RIF (30)

PMID Text
26382247 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire
25667418 Data suggest the proinflammatory potential of NKG2C(bright) NK cells.
25636564 genetic polymorphism is not associated with nasopharyngeal carcinoma in China
25150297 lack of expression of NKG2C may be associated with altered control of human cytomegalovirus infection in childhood
24740502 NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus.
24305414 No difference in the prevalence of NKG2C deletion was observed.
24079744 NKG2C receptor deletion and a functional polymorphism in its ligand HLA-E may play a role in psoriasis susceptibility
24030638 NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus.
23918974 coexpression of killer cell Ig-like receptor (KIR) and NKG2C on expanded NK cell subsets could be related to a functional contribution of KIR in cytomegalovirus infection
23911737 NKG2Cnull does not seem to constitute a risk factor for HPV-induced cervical lesions.
More...

AA Sequence

MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEE     71 - 140
SLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQ    141 - 210
VNRLKSAQCGSSMIYHCKHKL                                                     211 - 231
//

Text Mined References (42)

PMID Year Title
26382247 2015 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire.
25667418 2015 Antibody-mediated response of NKG2Cbright NK cells against human cytomegalovirus.
25636564 2015 NKG2C copy number variations in five distinct populations in mainland China and susceptibility to nasopharyngeal carcinoma (NPC).
25150297 2014 Rapid NK cell differentiation in a population with near-universal human cytomegalovirus infection is attenuated by NKG2C deletions.
24740502 2014 Cutting edge: NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus.
24305414 2014 NKG2C gene deletion in the Mexican population and lack of association to respiratory viral infections.
24079744 2013 Deletion of the activating NKG2C receptor and a functional polymorphism in its ligand HLA-E in psoriasis susceptibility.
24030638 2013 NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus.
23918974 2013 Amplified NKG2C+ NK cells in cytomegalovirus (CMV) infection preferentially express killer cell Ig-like receptor 2DL: functional impact in controlling CMV-infected dendritic cells.
23911737 2013 Evaluation of the association of NKG2C copy number variations with susceptibility to human papillomavirus-induced cervical lesions.
More...