Property Summary

NCBI Gene PubMed Count 68
Grant Count 151
R01 Count 89
Funding $19,482,212.59
PubMed Score 255.78
PubTator Score 208.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 0.000

Synonym

Accession P26715
Symbols NKG2
NKG2A
CD159A

Gene

PDB

3CDG   3CII   2RMX   2YU7   3BDW  

Gene RIF (55)

PMID Text
26856773 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26453750 Coengagement of inhibitory receptors, either KIR2DL1 or CD94-NKG2A, did not inhibit phosphorylation of Stat5 but inhibited selectively phosphorylation of Akt and S6 ribosomal protein.
26453102 CD94 and NKG2A polymorphisms may contribute to genetic susceptibility to rheumatoid arthritis or affect the response to anti-TNF therapy in patients of Caucasian origin.
25220367 The presence of TIM3+and/or NKG2A+ T cells is associated with the absence of recurrences and a longer recurrence-free survival.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
22486170 Results suggested that the low expression level of CD94/NKG2A upon gammadelta T cell activation might lead to the over-activation of gammadelta T cells in patients with SLE.
21538351 The level of NKG2A expression on resting CD8-positive T cells inversely correlated with acquisition of regulatory function when activated.
21518478 The positive expression rate of NKG2D and NKG2A on NK cells and CD3(+) T cells in ALL patients was no significantly different from that in AML patients.
21212510 These results suggested that these glycans can interact with NKG2D and CD94 to modulate NK cell-dependent cytotoxicity.
20952657 NKG2A expression on gammadelta lymphoproliferative Disease of Large Granular Lymphocytes correlates with asymptomatic pathology, even in the presence of NKG2C coexpression.
More...

AA Sequence

MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK      1 - 70
LIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTW     71 - 140
EESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAV    141 - 210
LQVNRLKSAQCGSSIIYHCKHKL                                                   211 - 233
//

Text Mined References (69)

PMID Year Title
26856773 2016 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
26453102 2016 Influence of CD94 and NKG2A variants on susceptibility to rheumatoid arthritis and efficacy of anti-TNF treatment.
25416956 2014 A proteome-scale map of the human interactome network.
25220367 2015 Expression of coinhibitory receptors on T cells in the microenvironment of usual vulvar intraepithelial neoplasia is related to proinflammatory effector T cells and an increased recurrence-free survival.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
22486170 2012 Downregulation of CD94/NKG2A inhibitory receptor on decreased ?? T cells in patients with systemic lupus erythematosus.
21538351 2011 NKG2A is a marker for acquisition of regulatory function by human CD8+ T cells activated with anti-CD3 antibody.
21518478 2011 [Expression of NKG2D and NKG2A with their ligands MHC-I A/B and HLA-E in acute leukemia patients and its significance].
21212510 2011 Binding affinities of NKG2D and CD94 to sialyl Lewis X-expressing N-glycans and heparin.
More...