Property Summary

NCBI Gene PubMed Count 71
PubMed Score 267.28
PubTator Score 208.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 2.0e-25

Gene RIF (58)

AA Sequence

MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK      1 - 70
LIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTW     71 - 140
EESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAV    141 - 210
LQVNRLKSAQCGSSIIYHCKHKL                                                   211 - 233
//

Text Mined References (72)

PMID Year Title