Property Summary

NCBI Gene PubMed Count 133
PubMed Score 85.85
PubTator Score 61.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Centronuclear myopathy 27 3.817 1.9

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy -2.229 2.2e-06
adrenocortical adenoma -1.258 2.7e-02
adrenocortical carcinoma -1.734 7.9e-05
Atopic dermatitis -1.900 1.5e-03
Becker muscular dystrophy -1.056 2.0e-02
Breast cancer 1.700 4.3e-02
colon cancer -2.200 1.2e-02
ependymoma 1.600 1.2e-02
fibroadenoma -1.300 3.2e-02
hereditary spastic paraplegia -1.150 5.9e-03
interstitial cystitis 2.600 4.6e-04
intraductal papillary-mucinous adenoma (... -2.400 2.4e-04
intraductal papillary-mucinous carcinoma... -2.300 2.5e-03
intraductal papillary-mucinous neoplasm ... -2.000 1.6e-02
limb girdle muscular dystrophy 2A -1.145 6.2e-05
lung adenocarcinoma -1.600 1.4e-05
lung carcinoma -1.200 1.2e-05
non-small cell lung cancer -1.644 4.5e-08
psoriasis -1.200 2.1e-03

Gene RIF (76)

AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL                        1 - 52
//

Text Mined References (136)

PMID Year Title