Property Summary

NCBI Gene PubMed Count 130
Grant Count 264
R01 Count 156
Funding $41,413,557.56
PubMed Score 84.75
PubTator Score 61.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26678 PLB
Symbols PLB
CMD1P
CMH18

Gene

PLN

PDB

1K9N   1KCH   1PLN   1PLP   1PSL   1ZLL   2HYN  

Gene RIF (73)

PMID Text
26966065 These data suggest that PLN is, at least partially, oligo-ubiquitinated at Lys(3) and degraded through Ser(16)-phosphorylation-mediated poly-ubiquitination during heart failure.
26743715 Phospholamban and sarcolipin are membrane proteins that differentially regulate SERCA function. (Review)
26542032 PLN may be a key molecular player in rigid substrate-induced cellular hypertrophy in eosinophilic esophagitis.
25983321 Although SLN and PLB binding to SERCA have different functional outcomes on the coupling efficiency of SERCA, both proteins decrease the apparent Ca(2+) affinity of the pump, suggesting that SLN and PLB inhibit SERCA by using a similar mechanism.
25928149 PLN mutations rarely cause cardiomyopathy
25775607 analysis of how the conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation
25563649 hereditary mutants of phospholamban are associated with heart failure [review]
25562800 PLN pentamers reduce phosphorylation of monomers at baseline and delay monomer phosphorylation upon PKA stimulation leading to increased interaction of PLN monomers with SERCA2a.
25504561 Engineered upregulation of PLB expression in hESC/iPSC-vCMs restores a positive inotropic response to beta-adrenergic stimulation.
25451386 Phospholamban, and its interacting partners, regulates excitation contraction coupling and myocardial contraction. [Review]
More...

AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL                        1 - 52
//

Text Mined References (133)

PMID Year Title
26970417 2016 Phospholamban p.Arg14del cardiomyopathy is characterized by phospholamban aggregates, aggresomes, and autophagic degradation.
26966065 2016 Phospholamban degradation is induced by phosphorylation-mediated ubiquitination and inhibited by interaction with cardiac type Sarco(endo)plasmic reticulum Ca(2+)-ATPase.
26917049 2016 Mutation analysis of the phospholamban gene in 315 South Africans with dilated, hypertrophic, peripartum and arrhythmogenic right ventricular cardiomyopathies.
26885692 2016 Cervical cancer systemic inflammation score: a novel predictor of prognosis.
26816378 2016 A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle.
26800703 2016 Sudden Cardiac Arrest and Rare Genetic Variants in the Community.
26791827 2016 Intensive training and reduced volume increases muscle FXYD1 expression and phosphorylation at rest and during exercise in athletes.
26743715 2016 Phospholamban and sarcolipin: Are they functionally redundant or distinct regulators of the Sarco(Endo)Plasmic Reticulum Calcium ATPase?
26673394 2016 Phospholamban spontaneously reconstitutes into giant unilamellar vesicles where it generates a cation selective channel.
26643481 2016 Search for Rare Copy-Number Variants in Congenital Heart Defects Identifies Novel Candidate Genes and a Potential Role for FOXC1 in Patients With Coarctation of the Aorta.
More...