Property Summary

NCBI Gene PubMed Count 166
PubMed Score 236.56
PubTator Score 167.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 2.000 2.9e-02
adrenocortical carcinoma -1.553 6.7e-04
aldosterone-producing adenoma -1.467 4.5e-02
astrocytoma 2.000 4.2e-04
breast carcinoma -1.200 3.8e-03
colon cancer -2.000 9.2e-03
fibroadenoma -1.900 1.5e-02
glioblastoma 2.300 1.2e-03
group 3 medulloblastoma -1.200 2.6e-02
inflammatory breast cancer -3.100 3.7e-08
intraductal papillary-mucinous adenoma (... -1.100 6.6e-03
lung adenocarcinoma -1.100 2.9e-06
lung cancer -4.000 1.4e-06
lung carcinoma -2.900 1.8e-15
mucosa-associated lymphoid tissue lympho... 1.111 1.7e-02
nephrosclerosis -1.226 4.2e-05
non diabetic and post-ischemic heart fai... -1.200 1.2e-02
non-small cell lung cancer -2.149 1.4e-22
pancreatic cancer 2.100 2.1e-03
pituitary cancer -2.500 5.0e-06
primary pancreatic ductal adenocarcinoma 2.161 2.9e-03
psoriasis 1.100 3.0e-03
urothelial carcinoma -1.700 5.9e-04

Protein-protein Interaction (1)

Gene RIF (136)

AA Sequence

MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWV      1 - 70
PPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHP     71 - 140
KYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSS    141 - 210
SSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSD    211 - 280
PDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE                            281 - 326
//

Text Mined References (179)

PMID Year Title