Property Summary

NCBI Gene PubMed Count 158
Grant Count 125
R01 Count 69
Funding $15,986,584.55
PubMed Score 220.26
PubTator Score 167.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P26651 B2RA54
Symbols TTP
G0S24
GOS24
TIS11
NUP475
zfp-36
RNF162A

Gene

PDB

4J8S  

Gene RIF (127)

PMID Text
26820662 PP2A activators boost the anti-inflammatory function of TTP and have implications for future pharmacotherapeutic strategies to combat inflammation in respiratory disease.
26644407 Involvement of LARP4 as a target of TNF-alpha-TTP regulation provides a clue as to how its functional activity may be used in a physiologic pathway.
26551835 The mRNA destabilizing activity of TTP was increased when the partially disordered RNA binding domain (RBD) of TTP was replaced with the fully structured RBD of TIS11d, indicating that differences in the folded state of the RBD affect the activity of the proteins in the cell.
26546680 DUSP1 overexpression and inhibition of MAPKs prevented IL1B-induced expression of ZFP36, this was associated with increased TNF mRNA expression at 6 h, an effect that was predominantly due to elevated transcription.
26517838 TTP might regulate interleukin (IL)-6 and IL-18 expression in diabetes. Diabetes with clinical proteinuria is accompanied by decreased urinary and serum level of TTP mRNA and protein, and increased levels of IL-6 and IL-18 mRNA and protein.
26497679 Tristetraprolin induces cell cycle arrest in breast tumor cells by targeting AP-1/c-Jun and NF-kappaB/RelA pathway.
26486958 TTP-dependent regulatory pathway described herein likely contributes to the role of IL-22 in inflammation and cancer and may evolve as novel target for pharmacological IL-22 modulation.
26370510 Tristetraprolin (TTP) recruits eukaryotic initiation factor 4E2 (eIF4E2) to repress target mRNA translation.
26356262 Results suggest that miR-29a acts as an oncogene by down regulating TTP and suggest the potential of miR-29a and TTP as biomarkers.
26125882 Logistic regression analyses demonstrated that TNF-alpha and the three ZFP36 gene polymorphisms were not independently associated with obstructive sleep apnea.
More...

AA Sequence

MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWV      1 - 70
PPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHP     71 - 140
KYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSS    141 - 210
SSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSD    211 - 280
PDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE                            281 - 326
//

Text Mined References (171)

PMID Year Title
27193233 2016 Destabilization of the ornithine decarboxylase mRNA transcript by the RNA-binding protein tristetraprolin.
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
26926077 2016 Interaction with Pyruvate Kinase M2 Destabilizes Tristetraprolin by Proteasome Degradation and Regulates Cell Proliferation in Breast Cancer.
26820662 2016 Activating protein phosphatase 2A (PP2A) enhances tristetraprolin (TTP) anti-inflammatory function in A549 lung epithelial cells.
26644407 2015 LARP4 Is Regulated by Tumor Necrosis Factor Alpha in a Tristetraprolin-Dependent Manner.
26551835 2016 Three Residues Make an Evolutionary Switch for Folding and RNA-Destabilizing Activity in the TTP Family of Proteins.
26546680 2016 Negative Feed-forward Control of Tumor Necrosis Factor (TNF) by Tristetraprolin (ZFP36) Is Limited by the Mitogen-activated Protein Kinase Phosphatase, Dual-specificity Phosphatase 1 (DUSP1): IMPLICATIONS FOR REGULATION BY GLUCOCORTICOIDS.
26517838 2015 The Expression of Tristetraprolin and Its Relationship with Urinary Proteins in Patients with Diabetic Nephropathy.
26497679 2015 Tristetraprolin induces cell cycle arrest in breast tumor cells through targeting AP-1/c-Jun and NF-?B pathway.
26486958 2015 Tristetraprolin regulation of interleukin-22 production.
More...