Property Summary

NCBI Gene PubMed Count 37
PubMed Score 0.00
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26641 B4DTG2 Q6PJ62 Q6PK31 Q96CU2 Q9P196 EF-1-gamma
Symbols EF1G
GIG35

Gene

PDB

1PBU  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (5)

PMID Text
23125841 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22944692 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22628567 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
21217813 eEF1gamma, in addition to its role in translation elongation complex, is involved in regulating Vimentin gene by contacting both pol II and the Vimentin promoter region and shuttling/nursing the Vimentin mRNA

AA Sequence

MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF      1 - 70
ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG     71 - 140
LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC    141 - 210
EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF    211 - 280
AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD    281 - 350
KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE    351 - 420
GAFQHVGKAFNQGKIFK                                                         421 - 437
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
More...