Property Summary

NCBI Gene PubMed Count 37
Grant Count 5
R01 Count 5
Funding $294,238.67
PubMed Score 0.00
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
23125841 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
23125841 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
23125841 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
23125841 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22944692 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22628567 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
22628567 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1
21217813 eEF1gamma, in addition to its role in translation elongation complex, is involved in regulating Vimentin gene by contacting both pol II and the Vimentin promoter region and shuttling/nursing the Vimentin mRNA

AA Sequence

MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF      1 - 70
ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG     71 - 140
LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC    141 - 210
EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF    211 - 280
AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD    281 - 350
KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE    351 - 420
GAFQHVGKAFNQGKIFK                                                         421 - 437
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
More...