| Tbio | Elongation factor 1-gamma |
Probably plays a role in anchoring the complex to other cellular components.
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008]
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008]
Comments
Property Summary
| NCBI Gene PubMed Count | 37 |
| Grant Count | 5 |
| R01 Count | 5 |
| Funding | $294,238.67 |
| PubMed Score | 0.00 |
| PubTator Score | 23.25 |
| PMID | Text |
|---|---|
| 23125841 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 23125841 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 23125841 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 23125841 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 22944692 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 22721673 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 22628567 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 22628567 | Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein translational elongation factor 1 |
| 21217813 | eEF1gamma, in addition to its role in translation elongation complex, is involved in regulating Vimentin gene by contacting both pol II and the Vimentin promoter region and shuttling/nursing the Vimentin mRNA |
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF 1 - 70 ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG 71 - 140 LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC 141 - 210 EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF 211 - 280 AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD 281 - 350 KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE 351 - 420 GAFQHVGKAFNQGKIFK 421 - 437 //
| PMID | Year | Title |
|---|---|---|
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 25114211 | 2014 | Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| 23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
| 22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
| 21908771 | 2011 | The first identification of lysine malonylation substrates and its regulatory enzyme. |
| More... |
