Property Summary

Ligand Count 3
NCBI Gene PubMed Count 20
PubMed Score 93.03
PubTator Score 44.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.321 5.1e-10
atypical teratoid / rhabdoid tumor 1.100 5.5e-04
colon cancer 1.500 1.0e-02
diabetes mellitus -1.200 2.9e-03
group 3 medulloblastoma 1.600 1.2e-04
lung adenocarcinoma 1.300 4.4e-11
lung cancer 1.400 2.7e-04
medulloblastoma, large-cell 1.500 1.3e-03
Multiple myeloma 1.367 2.6e-04
non-small cell lung cancer 1.274 1.3e-13
ovarian cancer 1.700 9.9e-06
pituitary cancer -1.300 7.3e-06
psoriasis 1.700 8.6e-05
tuberculosis 1.100 1.3e-06

Gene RIF (4)

AA Sequence

MSTLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPALEQGPGGLWVW      1 - 70
GATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALGLRSSAQDPQAVLGALGRALS     71 - 140
PLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVLY    141 - 210
SGARPLSHQPGPEAPALPKTAAQLKKEAKKREKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITY    211 - 280
DLPTPPGEKKDVSGPMPDSYSPRYVEAAWYPWWEQQGFFKPEYGRPNVSAANPRGVFMMCIPPPNVTGSL    281 - 350
HLGHALTNAIQDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLQEVWKWK    351 - 420
EEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGIIYRSTRLVNWSCTLNSAISDIEV    421 - 490
DKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIETMLGDVAVAVHPKDTRYQHLK    491 - 560
GKNVIHPFLSRSLPIVFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVPPPFLG    561 - 630
LPRFEARKAVLVALKERGLFRGIEDNPMVVPLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRI    631 - 700
LPEAHQRTWHAWMDNIREWCISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKE    701 - 770
FGVSPDKISLQQDEDVLDTWFSSGLFPLSILGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKL    771 - 840
TGRLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEKAKEGQKADF    841 - 910
PAGIPECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFALRGLGKGFVPSPTSQPGGHE    911 - 980
SLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLY    981 - 1050
TCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRS   1051 - 1120
LRADYNLTRIRPDCFLEVADEATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQ   1121 - 1190
LQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALF   1191 - 1260
QKML                                                                     1261 - 1264
//

Text Mined References (28)

PMID Year Title