Property Summary

Ligand Count 16
NCBI Gene PubMed Count 21
PubMed Score 405.94
PubTator Score 42.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
dermatomyositis 1.200 1.2e-02
glioblastoma 1.200 3.1e-02
juvenile dermatomyositis 1.085 6.0e-09
lung cancer 1.200 1.8e-02
Multiple myeloma 1.420 6.9e-04
non-small cell lung cancer 1.206 4.6e-18
ovarian cancer 2.100 1.0e-04
sonic hedgehog group medulloblastoma 1.300 1.4e-05
tuberculosis -1.100 6.7e-06
Waldenstrons macroglobulinemia 1.075 5.2e-03

Gene RIF (4)

AA Sequence

MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNILKAEHDS      1 - 70
ILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLE     71 - 140
LLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKII    141 - 210
KEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKN    211 - 280
SSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGA    281 - 350
YIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF    351 - 420
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVF    421 - 490
GFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCAT    491 - 560
IQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTC    561 - 630
DEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT    631 - 700
ISETIERLQQLKEFRSKQAEEEF                                                   701 - 723
//

Text Mined References (27)

PMID Year Title