Property Summary

NCBI Gene PubMed Count 21
Grant Count 54
R01 Count 40
Funding $10,872,601.97
PubMed Score 386.14
PubTator Score 42.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.075 0.005
Multiple myeloma 1.420 0.001
glioblastoma 1.200 0.031
juvenile dermatomyositis 1.085 0.000
tuberculosis and treatment for 3 months -1.400 0.000
non-small cell lung cancer 1.206 0.000
lung cancer 1.200 0.018
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer 2.100 0.000
dermatomyositis 1.200 0.012

Gene RIF (4)

PMID Text
25163878 Results show that TARS expression is increased in epithelial ovarian cancer.
23425968 A previously undiscovered function for TARS as an angiogenic, pro-migratory extracellular signaling molecule.
23375620 Our series mainly underscores that interstitial lung disease is frequent in anti-PL7(tars antibody)patients, leading to high morbidity.
22190034 HIV-1 MA is identified to have a physical interaction with threonyl-tRNA synthetase (TARS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNILKAEHDS      1 - 70
ILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLE     71 - 140
LLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKII    141 - 210
KEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKN    211 - 280
SSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGA    281 - 350
YIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF    351 - 420
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVF    421 - 490
GFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCAT    491 - 560
IQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTC    561 - 630
DEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT    631 - 700
ISETIERLQQLKEFRSKQAEEEF                                                   701 - 723
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25163878 2014 Threonyl-tRNA synthetase overexpression correlates with angiogenic markers and progression of human ovarian cancer.
23425968 2013 Secreted Threonyl-tRNA synthetase stimulates endothelial cell migration and angiogenesis.
23375620 2013 Clinical manifestations and outcome of anti-PL7 positive patients with antisynthetase syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...