Property Summary

NCBI Gene PubMed Count 112
PubMed Score 385.26
PubTator Score 563.57

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.25678726428472E-13
pediatric high grade glioma 2712 2.16524037660924E-10
sonic hedgehog group medulloblastoma 1482 2.64666623733269E-9
pilocytic astrocytoma 3086 3.15599427542056E-8
Duchenne muscular dystrophy 602 1.1520079947311E-7
atypical teratoid / rhabdoid tumor 4369 1.59315258921317E-7
medulloblastoma, large-cell 6234 4.41435363680105E-6
acute quadriplegic myopathy 1157 5.08688178678559E-6
astrocytoma 1493 6.67730883713406E-6
Multiple myeloma 1328 9.69831861012054E-6
ovarian cancer 8492 1.80035148281938E-5
primitive neuroectodermal tumor 3031 2.25028115273732E-5
osteosarcoma 7933 2.84875880346166E-5
psoriasis 6685 3.32534803955094E-4
glioblastoma 5572 0.00150643758904378
ependymoma 2514 0.00173842217582127
Waldenstrons macroglobulinemia 765 0.001854938014409
oligodendroglioma 2849 0.00239405220675597
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00454258526927777
diabetes mellitus 1663 0.0239171002368436
subependymal giant cell astrocytoma 2287 0.0467074987382809



Accession P26599 Q9BUQ0 PTB
Symbols PTB



1QM9   1SJQ   1SJR   2AD9   2ADB   2ADC   2EVZ   3ZZY   3ZZZ  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
2417 screening 4338 / 28974 / 106428 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment
2431 summary 0 / 0 / 0 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: Summary
2730 confirmatory 56 / 35 / 28 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: Confirmation of PNC Inhibition
2731 confirmatory 0 / 13 / 106 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: PC3M Caspase 3/7 Activation
2733 confirmatory 35 / 55 / 29 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: PC3M Cytotoxicity
2734 confirmatory 8 / 90 / 21 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: DNA Intercalation/PicoGreen Displacement Assay
588722 other 8 / 0 / 3 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment:Cell Migration
588739 other 0 / 0 / 0 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment:Soft Agar Assay
588740 confirmatory 1 / 0 / 0 PC3M Cytotoxicity Assay for Compounds that Inhibit the Perinuclear Compartment: SAR

Gene RIF (72)

26744779 The polypyrimidine tract binding protein 1 (PTBP1) shields specific retroviral and cellular transcripts from nonsense-mediated mRNA decay.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
26339049 HUR competes with the host protein PTB, which is a negative regulator of hepatitis C virus replication.
26336992 Results suggest that the role of polypyrimidine tract binding protein 1 (PTBP1) in tumorigenesis may be partly mediated by its regulation of cdc42 GTP-binding protein (CDC42) alternative splicing and CDC42-v2 might function as a tumor suppressor.
26234680 findings point to PKM2 and PTBP1 as new potential therapeutic targets to improve response of PDAC to chemotherapy
26047657 Data show that the protein levels of polypyrimidine tract binding protein 1 (PTBP1) and adenosine deaminase RNA-specific binding protein ADAR1 were cooperatively expressed in glioma tissues and cells.
25927630 impact of PTBP1 rs11085226 on glucose-stimulated insulin release
25904505 Data indicate that polypyrimidine tract-binding protein (PTBP1) is preferentially overexpressed in clinical colorectal cancers
25818238 Suggest that miR-124 acts as a tumor-suppressor and a modulator of energy metabolism through a PTB1/PKM1/PKM2 feedback cascade in human colorectal tumor cells.
25800779 protein knockdown enhances neurogenesis

AA Sequence

RKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI                                 491 - 531

Text Mined References (124)

PMID Year Title
26744779 2016 Polypyrimidine tract binding protein 1 protects mRNAs from recognition by the nonsense-mediated mRNA decay pathway.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
26339049 2015 HuR Displaces Polypyrimidine Tract Binding Protein To Facilitate La Binding to the 3' Untranslated Region and Enhances Hepatitis C Virus Replication.
26336992 2015 Regulation and functional significance of CDC42 alternative splicing in ovarian cancer.
26234680 2016 Modulation of PKM alternative splicing by PTBP1 promotes gemcitabine resistance in pancreatic cancer cells.
26047657 2015 PTBP1 induces ADAR1 p110 isoform expression through IRES-like dependent translation control and influences cell proliferation in gliomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25927630 2015 Impact of PTBP1 rs11085226 on glucose-stimulated insulin release in adult Danes.
25904505 2015 Significance of Polypyrimidine Tract-Binding Protein 1 Expression in Colorectal Cancer.
25818238 2015 MicroRNA-124 inhibits cancer cell growth through PTB1/PKM1/PKM2 feedback cascade in colorectal cancer.