Property Summary

NCBI Gene PubMed Count 125
PubMed Score 405.73
PubTator Score 563.57

Knowledge Summary


No data available


  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.260 5.1e-06
adult high grade glioma 1.600 3.1e-06
astrocytic glioma 1.200 3.8e-02
Astrocytoma, Pilocytic 1.300 2.0e-08
atypical teratoid / rhabdoid tumor 2.000 1.7e-11
autosomal dominant Emery-Dreifuss muscul... 1.034 4.5e-03
diabetes mellitus -1.200 2.4e-02
Duchenne muscular dystrophy 1.065 4.0e-08
ependymoma 1.900 1.5e-02
glioblastoma 1.600 8.1e-12
group 3 medulloblastoma 1.900 3.6e-06
juvenile dermatomyositis 1.158 3.3e-13
medulloblastoma, large-cell 1.800 4.5e-06
Multiple myeloma 1.111 3.0e-04
oligodendroglioma 1.300 2.5e-02
osteosarcoma -1.611 2.8e-05
ovarian cancer 1.900 2.8e-05
primitive neuroectodermal tumor 1.400 2.5e-05
psoriasis 1.400 3.3e-04
subependymal giant cell astrocytoma 1.041 4.7e-02
Waldenstrons macroglobulinemia 1.099 5.1e-03

Gene RIF (84)

AA Sequence

RKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI                                 491 - 531

Text Mined References (138)

PMID Year Title