Property Summary

NCBI Gene PubMed Count 65
PubMed Score 34.45
PubTator Score 166.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (30)

AA Sequence

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR      1 - 70
YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD     71 - 140
KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE     141 - 209
//

Text Mined References (76)

PMID Year Title