Property Summary

NCBI Gene PubMed Count 59
Grant Count 46
R01 Count 33
Funding $4,208,191.53
PubMed Score 33.56
PubTator Score 166.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
25937287 Lrp1-antisense directly binds to high-mobility group box 2 (Hmgb2) and inhibits the activity of Hmgb2 to enhance Srebp1a-dependent transcription of Lrp1.
25327479 siRNA-mediated silencing of HMGB2 increased the sensitivity of the head and neck squamous cell carcinoma cell lines to cisplatin and 5-fluorouracil.
25284587 Data show that odulation of RNA helicase DDX18 directly affects growth of tamoxifen-resistant cells, suggesting that it may be a critical downstream effector of the estrogen receptors (ERs) and high mobility group box 2 (HMGB2) complex.
25060178 the combination of a HMGB1+ and HMGB2- expression potentially predicts a poor prognosis in patients with pancreatic ductal adenocarcinoma
24684392 This study found that single nucleotide polymorphisms of HMGB1 may serve as potential biomarkers for predicting the efficacy of platinum-based chemotherapy.
23828241 The present data suggest that HMGB2 expression is a significant prognostic factor for glioblastoma and might play an important role in cell invasion.
23255232 HMGB2 is necessary to protect colorectal cancer cells from DNA damage and efficient DNA repair and p53-mediated downregulation is a critical mechanism of modulating HMGB2 expression.
23143110 Transient local HMGB2-DNA contacts dominate the DNA-bending mechanism used by HMGB proteins to increase DNA flexibility.
22644337 Crohn's disease in the colon and ulcerative colitis can be differentially diagnosed using anti-HMGB/HMGB2 antibodies combined with anti-Saccharomyces cerevisiae antibodies.
21890638 The age-related loss of HMGB2 in articular cartilage may represent a mechanism responsible for the decline in adult cartilage stem cell populations.
More...

AA Sequence

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR      1 - 70
YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD     71 - 140
KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE     141 - 209
//

Text Mined References (70)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25937287 2015 Antisense RNA controls LRP1 Sense transcript expression through interaction with a chromatin-associated protein, HMGB2.
25416956 2014 A proteome-scale map of the human interactome network.
25327479 2015 Silencing of high-mobility group box 2 (HMGB2) modulates cisplatin and 5-fluorouracil sensitivity in head and neck squamous cell carcinoma.
25284587 2015 Genomic interaction between ER and HMGB2 identifies DDX18 as a novel driver of endocrine resistance in breast cancer cells.
25060178 2014 The combination of a nuclear HMGB1-positive and HMGB2-negative expression is potentially associated with a shortened survival in patients with pancreatic ductal adenocarcinoma.
24684392 2014 Association of HMGB1 and HMGB2 genetic polymorphisms with lung cancer chemotherapy response.
24531895 2014 A systematic nomenclature for the redox states of high mobility group box (HMGB) proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877675 2013 Antimicrobial activity of high-mobility-group box 2: a new function to a well-known protein.
More...