Property Summary

Ligand Count 6
NCBI Gene PubMed Count 31
PubMed Score 74.70
PubTator Score 73.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 8.7e-06
psoriasis 6694 2.1e-04
osteosarcoma 7950 3.6e-03
non primary Sjogren syndrome sicca 891 4.0e-02
spina bifida 1074 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 4.0e-02
osteosarcoma -1.058 3.6e-03
ovarian cancer 1.700 8.7e-06
psoriasis -1.100 2.1e-04
spina bifida 1.041 4.5e-02

Gene RIF (14)

AA Sequence

MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQDAEVELERQRG      1 - 70
LLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVS     71 - 140
QDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVED    141 - 210
DLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELE    211 - 280
PKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQ    281 - 350
REAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV    351 - 420
TFQFRGRRVHLAPPLTWEGYDPSWN                                                 421 - 445
//

Text Mined References (33)

PMID Year Title