Property Summary

NCBI Gene PubMed Count 29
Grant Count 145
R01 Count 76
Funding $33,131,533.49
PubMed Score 69.93
PubTator Score 73.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.100 0.000
osteosarcoma -1.058 0.004
non primary Sjogren syndrome sicca 1.100 0.040
spina bifida 1.041 0.045
ovarian cancer 1.700 0.000

Synonym

Accession P26572 A8K404 B3KRU8 D3DWR1 Q6IBE3
Symbols GnTI
MGAT
GLCT1
GLYT1
GNT-1
GNT-I
GLCNAC-TI

Gene

Gene RIF (12)

PMID Text
26371870 The authors show here that the luminal domain of GnT1IP-L contains its MGAT1 inhibitory activity.
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24572742 The IL2RA and IL7RA variants had univariate association in MS and T1D, whereas the MGAT1 and CTLA-4 variants associated with only MS or T1D, respectively.
22957033 analysis of suppression of cancer progression by MGAT1 shRNA knockdown
21304485 Genetic variants downstream MGAT1 seem to influence susceptibility to obesity. Moreover, these genetic variants affect the levels of serum unsaturated fatty acids and Delta desaturase indices, variables previously shown to correlate with obesity.
20335257 HIV-1 Env trimers expressing in the absence of GNTI have a mass of 394-390 kDa compared to the parent trimers of about 420 kDa. HIV-1 produced in the absence of GNTI is infectious
19851299 The analysis enabled us to identify a new candidate gene, MGAT1, associated with weight in women.
19851299 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19826906 Activity of HuGnTI in plants is limited by a combination of reduced protein stability, alternative protein targeting and possibly to some extend to lower enzymatic performance of the catalytic domain in the plant biochemical environment.
19219857 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQDAEVELERQRG      1 - 70
LLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVS     71 - 140
QDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVED    141 - 210
DLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELE    211 - 280
PKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQ    281 - 350
REAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV    351 - 420
TFQFRGRRVHLAPPLTWEGYDPSWN                                                 421 - 445
//

Text Mined References (31)

PMID Year Title
26371870 2015 GnT1IP-L specifically inhibits MGAT1 in the Golgi via its luminal domain.
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24572742 2014 Family studies of type 1 diabetes reveal additive and epistatic effects between MGAT1 and three other polymorphisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22957033 2012 Suppression of cancer progression by MGAT1 shRNA knockdown.
21304485 2012 Genetic variants near the MGAT1 gene are associated with body weight, BMI and fatty acid metabolism among adults and children.
More...