Property Summary

NCBI Gene PubMed Count 280
PubMed Score 622.25
PubTator Score 419.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Degenerative polyarthritis 115

Expression

  Differential Expression (36)

Disease log2 FC p
adult high grade glioma 1.600 6.7e-04
Alzheimer's disease 1.200 2.6e-02
Amyotrophic lateral sclerosis 1.306 2.3e-05
Astrocytoma, Pilocytic 1.600 5.9e-06
atypical teratoid / rhabdoid tumor 2.800 6.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.002 3.3e-02
Becker muscular dystrophy 2.394 1.1e-05
colon cancer -1.900 9.3e-03
cystic fibrosis -1.477 6.3e-05
diabetes mellitus -1.400 2.0e-03
Duchenne muscular dystrophy 2.398 3.7e-11
ductal carcinoma in situ -1.600 2.4e-03
ependymoma 1.500 3.5e-05
fibroadenoma -1.400 2.8e-02
gastric carcinoma 1.600 1.5e-02
glioblastoma 1.700 9.4e-04
head and neck cancer -1.100 5.1e-03
intraductal papillary-mucinous neoplasm ... 2.600 3.3e-04
invasive ductal carcinoma -1.700 7.0e-03
limb girdle muscular dystrophy 2A 2.271 1.5e-07
lung adenocarcinoma -1.100 2.7e-03
lung cancer -4.100 1.3e-06
lung carcinoma -2.200 3.1e-27
malignant mesothelioma 2.800 1.2e-08
nephrosclerosis 1.155 7.7e-04
non-small cell lung cancer -2.088 7.6e-20
ovarian cancer 3.200 8.4e-05
pancreatic cancer 2.100 1.5e-05
Pick disease 1.400 7.9e-03
primary pancreatic ductal adenocarcinoma 1.981 1.2e-02
psoriasis -1.400 4.2e-04
subependymal giant cell astrocytoma 3.039 1.7e-03
tuberculosis 1.400 3.6e-07
ulcerative colitis 2.100 1.0e-04
Waldenstrons macroglobulinemia 1.248 2.2e-02
X-linked cerebral adrenoleukodystrophy -1.400 2.7e-02

PDB (14)

Gene RIF (237)

AA Sequence

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV      1 - 70
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK                                            71 - 101
//

Text Mined References (285)

PMID Year Title