Property Summary

NCBI Gene PubMed Count 280
PubMed Score 622.25
PubTator Score 419.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Degenerative polyarthritis 115

Expression

  Differential Expression (36)

Disease log2 FC p
adult high grade glioma 1.600 6.7e-04
Alzheimer's disease 1.200 2.6e-02
Amyotrophic lateral sclerosis 1.306 2.3e-05
Astrocytoma, Pilocytic 1.600 5.9e-06
atypical teratoid / rhabdoid tumor 2.800 6.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.002 3.3e-02
Becker muscular dystrophy 2.394 1.1e-05
colon cancer -1.900 9.3e-03
cystic fibrosis -1.477 6.3e-05
diabetes mellitus -1.400 2.0e-03
Duchenne muscular dystrophy 2.398 3.7e-11
ductal carcinoma in situ -1.600 2.4e-03
ependymoma 1.500 3.5e-05
fibroadenoma -1.400 2.8e-02
gastric carcinoma 1.600 1.5e-02
glioblastoma 1.700 9.4e-04
head and neck cancer -1.100 5.1e-03
intraductal papillary-mucinous neoplasm ... 2.600 3.3e-04
invasive ductal carcinoma -1.700 7.0e-03
limb girdle muscular dystrophy 2A 2.271 1.5e-07
lung adenocarcinoma -1.100 2.7e-03
lung cancer -4.100 1.3e-06
lung carcinoma -2.200 3.1e-27
malignant mesothelioma 2.800 1.2e-08
nephrosclerosis 1.155 7.7e-04
non-small cell lung cancer -2.088 7.6e-20
ovarian cancer 3.200 8.4e-05
pancreatic cancer 2.100 1.5e-05
Pick disease 1.400 7.9e-03
primary pancreatic ductal adenocarcinoma 1.981 1.2e-02
psoriasis -1.400 4.2e-04
subependymal giant cell astrocytoma 3.039 1.7e-03
tuberculosis 1.400 3.6e-07
ulcerative colitis 2.100 1.0e-04
Waldenstrons macroglobulinemia 1.248 2.2e-02
X-linked cerebral adrenoleukodystrophy -1.400 2.7e-02

Synonym

Accession P26447 A8K7R8 D3DV46 Q6ICP8
Symbols 42A
18A2
CAPL
FSP1
MTS1
P9KA
PEL98

Gene

PDB

1M31   2LNK   2MRD   2Q91   3C1V   3CGA   3KO0   3M0W   3ZWH   4CFQ   4CFR   4ETO   4HSZ   5LPU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (237)

AA Sequence

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV      1 - 70
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK                                            71 - 101
//

Text Mined References (285)

PMID Year Title