Property Summary

NCBI Gene PubMed Count 253
Grant Count 144
R01 Count 98
Funding $12,268,749.11
PubMed Score 600.81
PubTator Score 419.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26447 A8K7R8 D3DV46 Q6ICP8
Symbols 42A
18A2
CAPL
FSP1
MTS1
P9KA
PEL98

Gene

PDB

1M31   2LNK   2MRD   2Q91   3C1V   3CGA   3KO0   3M0W   3ZWH   4CFQ   4CFR   4ETO   4HSZ  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
652163 screening 502 / 491 / 355332 S100A4: HTS Measured in Biochemical System Using Plate Reader - 7045-01_Inhibitor_SinglePoint_HTS_Activity
687001 confirmatory 33 / 3 / 919 S100A4: HTS Measured in Biochemical System Using Plate Reader - 7045-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (213)

PMID Text
26903691 Study shows that negative expression of S100A4 was significantly associated with higher 3-year OS rate and N0 stage for lymph node metastasis in pancreatic neoplasm tumor which suggest that S100A4 expression represents a potential marker for lymph node metastasis and a potential unfavorable factor for prognosis of patients with this disease.
26897964 EZH2 mediates the regulation of E-cadherin expression by S100A4 and controls the proliferation and migration of gastric cancer cells.
26741489 Downregulation of AKT3 increases migration and metastasis in triple negative breast cancer cells by upregulating S100A4.
26722531 S100A4 mRNA level is an important molecular biomarker for prediction of chemosensitivity to gemcitabine in unresectable pancreatic cancer.
26654597 Tag7-Mts1 complex causes chemotactic migration of lymphocytes, with NK cells being a preferred target.
26499072 S100A4 levels are elevated in human periodontal ligament cells in response to IL-1beta.
26497012 our data suggest a novel mechanism for mutant p53V143A accumulation and add a new facet to the role of S100A4 in cancer
26483185 Enhanced S100A4 expression was observed in remodeled intrapulmonary arteries of COPD patients.
26349943 Proximity ligation assay demonstrate proximity between S100A4 and cyclin B1 in vitro, while confocal microscopy showed S100A4 to localize to areas corresponding to centrosomes in mitotic cells prior to chromosome segregation.
26274343 PTCSC3 downregulates S100A4, leading to a reduction in cell motility and invasiveness. We propose that PTCSC3 impacts papillary thyroid cancer predisposition and carcinogenesis through the S100A4 pathway.
More...

AA Sequence

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV      1 - 70
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK                                            71 - 101
//

Text Mined References (258)

PMID Year Title
26903691 2016 Impact of S100A4 Expression on Clinicopathological Characteristics and Prognosis in Pancreatic Cancer: A Meta-Analysis.
26897964 2015 EZH2 Mediates the Regulation of S100A4 on E-cadherin Expression and the Proliferation, Migration of Gastric Cancer Cells.
26741489 2016 Downregulation of AKT3 Increases Migration and Metastasis in Triple Negative Breast Cancer Cells by Upregulating S100A4.
26722531 2015 Evaluation of S100A4 mRNA in EUS-FNA specimens for the assessment of chemosensitivity to gemcitabine from patients with unresectable pancreatic cancer.
26654597 2015 A new role for PGRP-S (Tag7) in immune defense: lymphocyte migration is induced by a chemoattractant complex of Tag7 with Mts1.
26499072 2015 S100A4 upregulation suppresses tissue ossification and enhances matrix degradation in experimental periodontitis models.
26497012 2015 S100A4 interacts with mutant p53 and affects gastric cancer MKN1 cell autophagy and differentiation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26483185 2015 Increased S100A4 expression in the vasculature of human COPD lungs and murine model of smoke-induced emphysema.
26349943 2015 Enrichment of nuclear S100A4 during G2/M in colorectal cancer cells: possible association with cyclin B1 and centrosomes.
More...