Property Summary

NCBI Gene PubMed Count 91
Grant Count 371
R01 Count 252
Funding $44,021,293.26
PubMed Score 991.25
PubTator Score 414.57

Knowledge Summary

Patent

No data available

Synonym

Accession P26441 B2RAB2 CNTF
Symbols HCNTF

Gene

PDB

1CNT  

Gene RIF (67)

PMID Text
26187860 CNTFR-specific mutants of CNTF have been developed that bind to the CNTFRalpha-LIFRbeta-gp130 receptor.
25833344 Human CNTF expression through lentiviral gene transfer in the rat striatum significantly decreased the levels of neuronal metabolites (N-acetyl-aspartate, N-acetyl-aspartyl-glutamate, and glutamate).
25118897 the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first time
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24191003 CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Muller glial cells.
23948898 In this review, CNTF plays an important role in neurogenesis and differentiation of neural stem cells.
23944834 The levels of expression and secretion of BDNF and CTNF of induced cells were assessed using immunocytochemical, Real-Time polymerase chain reaction, and enzyme linked immunosorbent assay (ELISA).
23676962 Report favourable allelic patterns of ACTN3 and CNTF genes on aerobic performance in athletes.
23654315 CNTF elevated in umbilical cord blood from pre-eclamptic pregnancies
23653362 Data indicate that aspirin increased mRNA and protein expression of CNTF in primary mouse and human astrocytes in a dose- and time-dependent manner.
More...

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEA      1 - 70
ERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEAD     71 - 140
GMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM              141 - 200
//

Text Mined References (92)

PMID Year Title
26187860 2015 Ciliary neurotrophic factor (CNTF): New facets of an old molecule for treating neurodegenerative and metabolic syndrome pathologies.
25833344 2015 The neuroprotective agent CNTF decreases neuronal metabolites in the rat striatum: an in vivo multimodal magnetic resonance imaging study.
25416956 2014 A proteome-scale map of the human interactome network.
25118897 2014 Neuroprotective properties of ciliary neurotrophic factor on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells.
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24191003 2013 CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Müller glial cells.
24129709 2013 Cross-talk between KLF4 and STAT3 regulates axon regeneration.
23948898 2013 Role of ciliary neurotrophic factor in the proliferation and differentiation of neural stem cells.
23944834 2013 Comparing brain-derived neurotrophic factor and ciliary neurotrophic factor secretion of induced neurotrophic factor secreting cells from human adipose and bone marrow-derived stem cells.
23676962 2013 Polymorphisms of alpha-actinin-3 and ciliary neurotrophic factor in national-level Italian athletes.
More...