Property Summary

NCBI Gene PubMed Count 93
PubMed Score 1015.47
PubTator Score 414.57

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (69)

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEA      1 - 70
ERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEAD     71 - 140
GMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM              141 - 200
//

Text Mined References (94)

PMID Year Title