Property Summary

NCBI Gene PubMed Count 36
PubMed Score 1365.72
PubTator Score 89.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.1e-06
lung carcinoma 1.100 9.0e-21
osteosarcoma -1.360 1.4e-06
ovarian cancer -1.200 1.3e-06
pancreatic ductal adenocarcinoma liver m... -1.649 5.4e-04

 GO Component (1)

Gene RIF (12)

AA Sequence

MATATRLLGWRVASWRLRPPLAGFVSQRAHSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDR      1 - 70
SNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRN     71 - 140
GNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITNGPDADVLIVYAK    141 - 210
TDLAAVPASRGITAFIVEKGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIPAANILGHENKGVYVLMSGL    211 - 280
DLERLVLAGGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEG    281 - 350
HCTAKDCAGVILYSAECATQVALDGIQCFGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGRAFNA    351 - 420
DFH                                                                       421 - 423
//

Text Mined References (44)

PMID Year Title