Property Summary

NCBI Gene PubMed Count 13
Grant Count 12
R01 Count 6
Funding $618,078
PubMed Score 185.80
PubTator Score 110.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
cutaneous lupus erythematosus 1.200 0.004
psoriasis 2.400 0.000
osteosarcoma 1.469 0.000
lung cancer 1.400 0.000
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
21488928 ACRV1 protein was predominantly located in round and elongated spermatids in testes, indicating that ACRV1 may play an important role in mammalian spermatogenesis

AA Sequence

MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGS      1 - 70
SEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPS     71 - 140
DEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCI    141 - 210
TQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI                   211 - 265
//

Text Mined References (13)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
21488928 2012 Developmental expression of ACRV1 in humans and mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11730901 2002 Transcriptional regulation of spermiogenesis: insights from the study of the gene encoding the acrosomal protein SP-10.
8373955 1993 Cloning and characterization of the gene coding for the human acrosomal protein SP-10.
8288254 1993 Refinement of the localization of the gene for human intraacrosomal protein SP-10 (ACRV1) to the junction of bands q23-->q24 of chromosome 11 by nonisotopic in situ hybridization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7888499 1994 Human SP-10: acrosomal distribution, processing, and fate after the acrosome reaction.
7619499 1995 Characterization of alternatively spliced human SP-10 mRNAs.
More...