Property Summary

NCBI Gene PubMed Count 45
Grant Count 107
R01 Count 62
Funding $24,749,982.58
PubMed Score 327.48
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 0.009
posterior fossa group B ependymoma -5.200 0.000
oligodendroglioma -1.800 0.019
glioblastoma -3.000 0.010
atypical teratoid / rhabdoid tumor -4.300 0.000
medulloblastoma, large-cell -2.600 0.020
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -2.900 0.000
sonic hedgehog group medulloblastoma 1.100 0.019
lung carcinoma 3.300 0.000
ovarian cancer 1.400 0.001

Synonym

Accession P26378 B1APY6 B1APY7 B7Z4G7 Q8IYD4 Q96J74 Q96J75 Q9UD24
Symbols HUD
PNEM

Gene

PDB

1FXL   1G2E  

Gene RIF (28)

PMID Text
25278027 study showed HuD is associated with histological grade, iffuse invasion and nodal metastasis in oral squamous cell carcinoma; it regulates expression of VEGF-A, VEGF-D, MMP-2 and MMP-9
24857657 HuD binds to the APP and BACE1 3' UTRs and increases APP and BACE1 levels.
24036060 Alzheimer's disease brain tissues with elevated neuroserpin protein also showed increased expression of THRbeta1 and HuD
23978401 Phosphomimetic mutation at position Ser 221 increased nuclear HUD export.
23618873 found that p97 and its cofactor, UBXD8, destabilize p21, MKP-1, and SIRT1, three established mRNA targets of the RNA-binding protein HuR, by promoting release of HuR from mRNA
22965691 It can be involved in the pathogenesis of meningiomas in male patients.
22387028 HuD is a pivotal regulator of insulin translation in pancreatic beta cells.
21491091 the endogenous function of ELAVL4 in relation to radiation sensitivity might be the regulation of cell proliferation and death
21282516 Complexes of HuD and Tax epitopes with HLA-A2 are close but imperfect structural mimics: alphabeta T-cell receptor with self antigens is driven to engage HuD in the same traditional binding mode as Tax.
19410329 alterations of nELAV genes could be involved in the onset and/or progression of a subset of neuroendocrine lung tumors.
More...

AA Sequence

MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG      1 - 70
EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP     71 - 140
KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA    141 - 210
NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDG    211 - 280
MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE    281 - 350
AAMAIASLNGYRLGDRVLQVSFKTNKAHKS                                            351 - 380
//

Text Mined References (48)

PMID Year Title
25278027 2014 HuD promotes progression of oral squamous cell carcinoma.
24857657 2014 HuD regulates coding and noncoding RNA to induce APP?A? processing.
24036060 2013 Neuroserpin up-regulation in the Alzheimer's disease brain is associated with elevated thyroid hormone receptor-?1 and HuD expression.
23978401 2013 Domain-specific phosphomimetic mutation allows dissection of different protein kinase C (PKC) isotype-triggered activities of the RNA binding protein HuR.
23618873 2013 The p97-UBXD8 complex destabilizes mRNA by promoting release of ubiquitinated HuR from mRNP.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22965691 2013 Reduced expression of ELAVL4 in male meningioma patients.
22387028 2012 RNA-binding protein HuD controls insulin translation.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
21491091 2011 Identification of ELAVL4 as a modulator of radiation sensitivity in A549 non-small cell lung cancer cells.
More...