Property Summary

NCBI Gene PubMed Count 46
PubMed Score 344.77
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 1.4e-04
astrocytic glioma -1.500 2.8e-02
Astrocytoma, Pilocytic -2.900 7.0e-07
atypical teratoid / rhabdoid tumor -3.900 1.1e-05
ependymoma -3.100 2.4e-02
glioblastoma -2.300 9.3e-06
lung carcinoma 3.300 6.4e-50
medulloblastoma, large-cell -2.600 2.0e-02
oligodendroglioma -1.400 4.9e-02
ovarian cancer 1.400 6.8e-04
sonic hedgehog group medulloblastoma 1.100 1.9e-02

Gene RIF (29)

AA Sequence

MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG      1 - 70
EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP     71 - 140
KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA    141 - 210
NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDG    211 - 280
MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE    281 - 350
AAMAIASLNGYRLGDRVLQVSFKTNKAHKS                                            351 - 380
//

Text Mined References (49)

PMID Year Title