Property Summary

NCBI Gene PubMed Count 21
PubMed Score 73.30
PubTator Score 36.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.629 2.3e-04
Alzheimer's disease -1.400 2.9e-02
astrocytic glioma -1.700 1.2e-02
Breast cancer 3.400 2.9e-02
ductal carcinoma in situ 1.100 1.2e-02
ependymoma -1.200 3.8e-02
group 4 medulloblastoma 1.200 4.9e-05
intraductal papillary-mucinous adenoma (... 1.400 4.4e-03
intraductal papillary-mucinous carcinoma... 1.800 3.3e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.0e-02
juvenile dermatomyositis 1.109 7.4e-08
lung cancer 1.700 4.3e-03
lung carcinoma -1.300 3.2e-13
medulloblastoma, large-cell 1.500 5.0e-05
osteosarcoma -1.257 3.7e-02
pancreatic cancer 1.200 1.0e-04
Pick disease -1.600 2.3e-03
pituitary cancer -1.300 5.2e-03
progressive supranuclear palsy -1.600 3.8e-02

Synonym

Accession P26374 B2RAB9 Q17RE0 Q9H1Y4
Symbols REP2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (3)

AA Sequence

MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLKEYQQNNDIGE      1 - 70
ESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALP     71 - 140
EESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKAD    141 - 210
EPIRNRITYSQIVKEGRRFNIDLVSKLLYSQGLLIDLLIKSDVSRYVEFKNVTRILAFREGKVEQVPCSR    211 - 280
ADVFNSKELTMVEKRMLMKFLTFCLEYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESS    281 - 350
CTTIDGLNATKNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIYCLRHKVQCFVVDKESGRCKA    351 - 420
IIDHFGQRINAKYFIVEDSYLSEETCSNVQYKQISRAVLITDQSILKTDLDQQTSILIVPPAEPGACAVR    421 - 490
VTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINEEELTKPRLLWALYFNMRDSS    491 - 560
GISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEIFPTEEFCPPPPNPEDIIFDGDDKQPEAPGT    561 - 630
NNVVMAKLESSEESKNLESPEKHLQN                                                631 - 656
//

Text Mined References (24)

PMID Year Title