Property Summary

NCBI Gene PubMed Count 21
Grant Count 9
R01 Count 6
Funding $757,188.5
PubMed Score 70.40
PubTator Score 36.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (3)

PMID Text
19626040 Observational study of gene-disease association. (HuGE Navigator)
18344558 Polymorphisms in the OPN3 and CHML genes are associated with asthma and atopic asthma.
18344558 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLKEYQQNNDIGE      1 - 70
ESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALP     71 - 140
EESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKAD    141 - 210
EPIRNRITYSQIVKEGRRFNIDLVSKLLYSQGLLIDLLIKSDVSRYVEFKNVTRILAFREGKVEQVPCSR    211 - 280
ADVFNSKELTMVEKRMLMKFLTFCLEYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESS    281 - 350
CTTIDGLNATKNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIYCLRHKVQCFVVDKESGRCKA    351 - 420
IIDHFGQRINAKYFIVEDSYLSEETCSNVQYKQISRAVLITDQSILKTDLDQQTSILIVPPAEPGACAVR    421 - 490
VTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINEEELTKPRLLWALYFNMRDSS    491 - 560
GISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEIFPTEEFCPPPPNPEDIIFDGDDKQPEAPGT    561 - 630
NNVVMAKLESSEESKNLESPEKHLQN                                                631 - 656
//

Text Mined References (24)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18344558 2008 Identification of a novel asthma susceptibility gene on chromosome 1qter and its functional evaluation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...