Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.19
PubTator Score 19.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P26373 B4DLX3 F5H1S2 Q3KQT8 Q567Q8 Q9BPX0
Symbols L13
BBC1
D16S44E
D16S444E

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (8)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ribosomal protein L13 (RPL13) expression by HIV-1 Vpr in Vpr transduced macrophages
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
16786168 Ribosomal protein L13 plays an essential role in the progression of some gastrointestinal malignancies.

AA Sequence

MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKV      1 - 70
RAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSS     71 - 140
AEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKK    141 - 210
K//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...