Property Summary

NCBI Gene PubMed Count 25
PubMed Score 34.99
PubTator Score 19.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.098 5.7e-08
adult high grade glioma -1.100 1.5e-03
Breast cancer -1.600 8.7e-15
colon cancer 1.300 4.1e-03
cystic fibrosis -1.100 1.8e-04
intraductal papillary-mucinous adenoma (... -1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... -1.500 5.2e-03
invasive ductal carcinoma -1.022 4.0e-04
lung adenocarcinoma -1.100 1.9e-05
lung cancer -4.000 2.1e-02
osteosarcoma -3.274 3.0e-10
ovarian cancer -1.500 5.7e-05
primary pancreatic ductal adenocarcinoma -1.135 3.0e-03
psoriasis -3.500 4.9e-06

Gene RIF (5)

AA Sequence

MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKV      1 - 70
RAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSS     71 - 140
AEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKK    141 - 210
K//

Text Mined References (38)

PMID Year Title