Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.200 1.1e-03

AA Sequence

MGCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRGCGSCGGSKG      1 - 70
GCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGC     71 - 140
GSSCCQSSCCKPCCSQSRCCVPVCYQCKI                                             141 - 169
//

Text Mined References (13)

PMID Year Title