Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.200 0.001

Synonym

Accession P26371 Q14564 Q3MIP8
Symbols KRN1
KRTAP5-1
KRTAP5.9

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MGCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRGCGSCGGSKG      1 - 70
GCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGC     71 - 140
GSSCCQSSCCKPCCSQSRCCVPVCYQCKI                                             141 - 169
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10023043 1999 Genomic organization and promoter characterization of two human UHS keratin genes.
1724400 1991 An ultrahigh-sulphur keratin gene of the human hair cuticle is located at 11q13 and cross-hybridizes with sequences at 11p15.
More...