Property Summary

NCBI Gene PubMed Count 403
Grant Count 674
R01 Count 393
Funding $91,932,773.54
PubMed Score 1415.15
PubTator Score 979.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P26358 A0AV63 B7ZLW6 Q9UHG5 Q9ULA2 Q9UMZ6 Dnmt1
Symbols AIM
DNMT
MCMT
CXXC9
HSN1E
ADCADN
m.HsaI

Gene

PDB

3EPZ   3PTA   3SWR   4WXX   4YOC  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
588458 screening 2975 / 0 / 356546 uHTS identification of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay
588464 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of DNMT1
602385 screening 181 / 0 / 2072 Single concentration confirmation of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay
602386 confirmatory 179 / 0 / 21 Dose response confirmation of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay

Gene RIF (346)

PMID Text
27087738 Results show that polymorphisms of the DNMT1 gene may affect overall survival of Gastric Cancer (GC) Patients. The SNP rs2228611 has the potentiality to serve as an independent prognostic marker for GC patients.
27071379 Tumor expression of DNMT1 in breast cancer differed by molecular subtype and stromal histological type.
27021683 miR-140-5p at least partly targets Dnmt1 and regulates SOD2 expression to inhibit proliferation and promote apoptosis and differentiation of HPASMCs in hypoxia
26929335 The subangstrom geometric and electrostatic structure of the major transition state of the reaction catalyzed by human DNMT1 is presented. The rate-limiting methyl transfer occurs after Cys(1226) attack to Cyt C6.
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26815200 Endothelial-Mesenchymal Transition is initiated by recruitment of aberrantly phosphorylated DNMT1 to the RASAL1 CpG island promoter by HDAC2, causing aberrant promoter methylation and transcriptional suppression.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26774342 We further demonstrate that such fibroblast activation is dependent on phosphate influx, aberrant phosphorylation of DNA methyltransferase DNMT1 and aberrant CpG island promoter methylation.
26676363 The inhibition of DNMT1 contributed to the activation of p53 pathways.
26602018 the abundance of BDNF positively correlated and phosphorylated DNMT1 inversely correlated with that of FKBP51 in cells
More...

AA Sequence

MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRK      1 - 70
EELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRR     71 - 140
SKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSR    141 - 210
ERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDE    211 - 280
KDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHP    281 - 350
PKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC    351 - 420
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMD    421 - 490
PSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQ    491 - 560
VESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDT    561 - 630
FFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEAD    631 - 700
DDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDS    701 - 770
SKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS    771 - 840
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRV    841 - 910
LEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYI    911 - 980
KGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAV    981 - 1050
VDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKP   1051 - 1120
KSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTED   1121 - 1190
CNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP   1191 - 1260
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEP   1261 - 1330
LHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQL   1331 - 1400
RGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSG   1401 - 1470
ALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVL   1471 - 1540
HPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKE   1541 - 1610
EEAAKD                                                                   1611 - 1616
//

Text Mined References (415)

PMID Year Title
27087738 2016 Polymorphisms of the DNA Methyltransferase 1 Gene Predict Survival of Gastric Cancer Patients Receiving Tumorectomy.
27071379 2016 Differential expression of the epigenetic methylation-related protein DNMT1 by breast cancer molecular subtype and stromal histology.
27021683 2016 MiR-140-5p regulates hypoxia-mediated human pulmonary artery smooth muscle cell proliferation, apoptosis and differentiation by targeting Dnmt1 and promoting SOD2 expression.
26929335 2016 Human DNMT1 transition state structure.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26815200 2016 DNMT1 and HDAC2 Cooperate to Facilitate Aberrant Promoter Methylation in Inorganic Phosphate-Induced Endothelial-Mesenchymal Transition.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26774342 2016 High inorganic phosphate causes DNMT1 phosphorylation and subsequent fibrotic fibroblast activation.
26676363 2016 Epigenetic repression of long non-coding RNA MEG3 mediated by DNMT1 represses the p53 pathway in gliomas.
26602018 2015 Chaperoning epigenetics: FKBP51 decreases the activity of DNMT1 and mediates epigenetic effects of the antidepressant paroxetine.
More...