Property Summary

Ligand Count 11
NCBI Gene PubMed Count 462
PubMed Score 1562.74
PubTator Score 979.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Neuropathy 261 0.0 4.0

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.051 3.1e-06
adrenocortical carcinoma 1.206 2.0e-04
astrocytoma 1.500 6.4e-03
dermatomyositis 1.300 2.0e-04
group 3 medulloblastoma 1.100 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
invasive ductal carcinoma 1.200 3.4e-03
juvenile dermatomyositis 1.545 2.6e-14
malignant mesothelioma 1.200 3.3e-06
ovarian cancer 2.100 6.0e-06
psoriasis 2.200 1.3e-04
ulcerative colitis 1.200 2.5e-06
Waldenstrons macroglobulinemia 1.179 4.6e-03

Gene RIF (402)

AA Sequence

MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRK      1 - 70
EELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRR     71 - 140
SKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSR    141 - 210
ERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDE    211 - 280
KDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHP    281 - 350
PKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC    351 - 420
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMD    421 - 490
PSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQ    491 - 560
VESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDT    561 - 630
FFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEAD    631 - 700
DDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDS    701 - 770
SKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS    771 - 840
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRV    841 - 910
LEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYI    911 - 980
KGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAV    981 - 1050
VDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKP   1051 - 1120
KSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTED   1121 - 1190
CNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP   1191 - 1260
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEP   1261 - 1330
LHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQL   1331 - 1400
RGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSG   1401 - 1470
ALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVL   1471 - 1540
HPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKE   1541 - 1610
EEAAKD                                                                   1611 - 1616
//

Text Mined References (475)

PMID Year Title