Property Summary

NCBI Gene PubMed Count 69
PubMed Score 65.56
PubTator Score 43.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
osteosarcoma 7950 2.4e-09
psoriasis 6694 6.6e-05
medulloblastoma, large-cell 6241 1.8e-03
Polycystic ovary syndrome 360 4.7e-03
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 23 3.382 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.300 1.8e-03
osteosarcoma -1.715 2.4e-09
Polycystic ovary syndrome 1.337 4.7e-03
psoriasis -3.100 6.6e-05

Protein-protein Interaction (9)

Gene RIF (41)

AA Sequence

MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGD      1 - 70
DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARA     71 - 140
KNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIM    141 - 210
RLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATF    211 - 280
PLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELL    281 - 350
AKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH    351 - 420
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP           421 - 483
//

Text Mined References (74)

PMID Year Title