Property Summary

NCBI Gene PubMed Count 64
Grant Count 26
R01 Count 19
Funding $3,219,112.32
PubMed Score 57.78
PubTator Score 43.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -3.100 0.000
osteosarcoma -1.715 0.000
medulloblastoma, large-cell -1.300 0.002
Polycystic Ovary Syndrome 1.337 0.005

Gene RIF (38)

PMID Text
26783102 DDX6 may have a role in radio- and chemoresistance in glioblastoma
26610392 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26412305 Results indicate that progenitor function is maintained by DDX6 complexes through two distinct pathways that include the degradation of differentiation-inducing transcripts and by promoting the translation of self-renewal and proliferation mRNAs.
26184334 Protein Interactome Analysis of DDX6
25995375 DDX6 repression complexes are required for P-body assembly.
25066606 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
25035296 CNOT1 facilitates recruitment of DDX6 to miRNA-targeted mRNAs, placing DDX6 as a downstream effector in the miRNA silencing pathway.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that DDX6 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with DDX6
24768540 Crystal structure of the DDX6, CNOT9 and CNOT1 complex.
More...

AA Sequence

MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGD      1 - 70
DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARA     71 - 140
KNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIM    141 - 210
RLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATF    211 - 280
PLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELL    281 - 350
AKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH    351 - 420
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP           421 - 483
//

Text Mined References (69)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26783102 2016 Involvement of DDX6 gene in radio- and chemoresistance in glioblastoma.
26610392 2015 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26412305 2015 DDX6 Orchestrates Mammalian Progenitor Function through the mRNA Degradation and Translation Pathways.
26184334 2015 Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.
26098573 2015 A conserved mechanism of TOR-dependent RCK-mediated mRNA degradation regulates autophagy.
25995375 2015 P-body assembly requires DDX6 repression complexes rather than decay or Ataxin2/2L complexes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
More...