Property Summary

NCBI Gene PubMed Count 32
Grant Count 1
R01 Count 1
Funding $76,577.29
PubMed Score 28.46
PubTator Score 30.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26045 A0AUW9 E7EN99 E9PGU7
Symbols PTPH1
PTP-H1

Gene

 Grant Application (1)

PDB

2B49   4QUM   4QUN   4RH5   4RH9   4RHG   4RI4   4RI5   4S0G  

Gene RIF (16)

PMID Text
25314968 analysis of how allosteric regulation of p38gamma and PTPN3 involves a PDZ domain-modulated complex formation
25263444 Results indicate that protein tyrosine phosphatase non-receptor type 3 (PTPN3) may act as a tumor suppressor in lung cancer through its modulation of epidermal growth factor receptor (EGFR) signaling.
24503127 Activating mutations in and high expression levels of PTPN3 were associated with tumor recurrence in cholangiocarcinoma.
24227889 These studies thus identified PTPH1 as a novel ER phosphatase and further demonstrate a therapeutic potential of enhancing breast cancer sensitivity to antiestrogens through dephosphorylating ER by PTPH1.
22730326 p38gamma Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.
22334442 The fusion transcript of ALK and PTPN3 identified resulted from translocation of a part of ALK gene into the third intron of PTPN3. Analysis of the transcript sequence indicates that no protein with any enzymatic activity is produced.
21119599 PTPH1 stimulated breast cancer growth through regulating vitamin D receptor expression. PTPH1 was overexpressed in primary breast cancer and levels of its protein expression positively correlated with clinical metastasis.
20332238 PTPH1 plays a role in Ras-dependent malignant growth by a mechanism depending on its p38gamma-binding activity. Ras increases p38gamma and PTPH1 expression and there is a coupling of increased p38gamma and PTPH1 protein expression in colon cancer.
18978678 Observational study of gene-disease association. (HuGE Navigator)
17947517 Data suggest that reducing the level of PTPH1 may contribute to the oncogenic activity of high-risk genital E6 proteins.
More...

AA Sequence

MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYF      1 - 70
GLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLT     71 - 140
CPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINI    141 - 210
ARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESR    211 - 280
EHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVW    281 - 350
NPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL    351 - 420
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGST    421 - 490
EDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIV    491 - 560
LINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTL    561 - 630
EGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASY    631 - 700
VNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGF    701 - 770
HIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV    771 - 840
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML    841 - 910
DPS                                                                       911 - 913
//

Publication (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25314968 2014 Reciprocal allosteric regulation of p38? and PTPN3 involves a PDZ domain-modulated complex formation.
25263444 2015 Protein tyrosine phosphatase PTPN3 inhibits lung cancer cell proliferation and migration by promoting EGFR endocytic degradation.
24503127 2014 Activating mutations in PTPN3 promote cholangiocarcinoma cell proliferation and migration and are associated with tumor recurrence in patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227889 2014 Protein-tyrosine phosphatase H1 increases breast cancer sensitivity to antiestrogens by dephosphorylating estrogen receptor at Tyr537.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730326 2012 p38? Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.
22334442 2012 Discovery of ALK-PTPN3 gene fusion from human non-small cell lung carcinoma cell line using next generation RNA sequencing.
21119599 2011 PTPH1 cooperates with vitamin D receptor to stimulate breast cancer growth through their mutual stabilization.
More...