Property Summary

NCBI Gene PubMed Count 35
PubMed Score 29.12
PubTator Score 30.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy -1.339 2.5e-04
adult high grade glioma -2.200 5.1e-04
astrocytic glioma -1.700 9.7e-03
Astrocytoma, Pilocytic -1.500 1.7e-04
atypical teratoid / rhabdoid tumor -1.700 8.5e-06
colon cancer 1.200 2.9e-03
Duchenne muscular dystrophy -1.114 7.0e-05
glioblastoma -1.800 1.8e-05
group 3 medulloblastoma -1.700 2.8e-02
interstitial cystitis -1.400 1.2e-03
malignant mesothelioma 1.900 5.8e-08
medulloblastoma, large-cell -1.800 2.0e-03
oligodendroglioma -1.400 2.4e-02
osteosarcoma 1.880 5.8e-03
pancreatic ductal adenocarcinoma liver m... -1.405 1.9e-02
pituitary cancer 1.400 4.0e-03
posterior fossa group B ependymoma 1.400 1.2e-04
primitive neuroectodermal tumor -1.200 2.9e-03
spina bifida -1.926 4.4e-02
subependymal giant cell astrocytoma -1.175 8.1e-03

Gene RIF (16)

AA Sequence

MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYF      1 - 70
GLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLT     71 - 140
CPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINI    141 - 210
ARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESR    211 - 280
EHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVW    281 - 350
NPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL    351 - 420
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGST    421 - 490
EDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIV    491 - 560
LINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTL    561 - 630
EGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASY    631 - 700
VNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGF    701 - 770
HIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV    771 - 840
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQML    841 - 910
DPS                                                                       911 - 913
//

Text Mined References (41)

PMID Year Title