Property Summary

NCBI Gene PubMed Count 162
Grant Count 241
R01 Count 164
Funding $16,609,942.14
PubMed Score 339.46
PubTator Score 723.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P26038
Symbols HEL70

Gene

MSN

PDB

1E5W   1EF1   1SGH  

Gene RIF (90)

PMID Text
26555866 Phospho-Ezrin/Radixin/Moesin (ERM) inhibit cell adhesion, and therefore, dephosphorylation of ERM proteins is essential for cell adhesion.Phospho-ERM induce formation and/or maintenance of spherical cell shape.
26209696 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26194050 results indicate Moesin may regulate cell motility through its interactions with MT1-MMP and E-cadherin/p120-catenin adhesion complex and cytoplasmic expression of Moesin correlates with nodal metastasis and poor prognosis of OSCCs
25947626 Moesin was required in HMGB1-induced F-actin rearrangement, hyperpermeability, and inflammatory responses. HMGB1 increased Thr558 phosphorylation of moesin. Moesin was elevated in sepsis.
25601651 both moesin-mediated inhibition and its localized deactivation by myosin phosphatase are essential for neutrophil polarization and effective neutrophil tracking of pathogens.
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
25406076 Moesin might be involved in renal fibrosis and its effects could be related to interacting with E-Cadherin.
25299115 Ezrin and moesin expression is related to LSCC invasion and metastasis, and may be important molecular markers for predicting prognosis and therapeutic targets in LSCC patients
25286001 Ezrin, radixin and moesin are unlikely targets for autoantibodies in demyelinating neuropathies.
25010044 STIP1 and moesin may be novel and differential sero-diagnostic markers for psoriasis vulgaris and psoriatic arthritis
More...

AA Sequence

MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV      1 - 70
RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE     71 - 140
VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN    141 - 210
KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER    281 - 350
LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE    351 - 420
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA    421 - 490
SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR    491 - 560
QIRQGNTKQRIDEFESM                                                         561 - 577
//

Text Mined References (173)

PMID Year Title
27357661 2016 Structural model of the dimeric Parkinson's protein LRRK2 reveals a compact architecture involving distant interdomain contacts.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26555866 2015 Inhibition of cell adhesion by phosphorylated Ezrin/Radixin/Moesin.
26209696 2015 Intracellular sphingosine kinase 2-derived sphingosine-1-phosphate mediates epidermal growth factor-induced ezrin-radixin-moesin phosphorylation and cancer cell invasion.
26194050 2015 Moesin regulates the motility of oral cancer cells via MT1-MMP and E-cadherin/p120-catenin adhesion complex.
25947626 2015 Role of moesin in HMGB1-stimulated severe inflammatory responses.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25601651 2015 Moesin and myosin phosphatase confine neutrophil orientation in a chemotactic gradient.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
25417112 2014 Target-selective protein S-nitrosylation by sequence motif recognition.
More...