Property Summary

NCBI Gene PubMed Count 176
PubMed Score 361.71
PubTator Score 723.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.219 5.0e-04
adult high grade glioma 1.500 1.6e-04
astrocytoma 2.600 6.7e-03
Astrocytoma, Pilocytic 1.700 4.4e-08
autosomal dominant Emery-Dreifuss muscul... 1.429 3.3e-03
Becker muscular dystrophy 1.199 6.1e-03
Breast cancer 1.100 4.4e-03
dermatomyositis 1.300 1.4e-02
Down syndrome 1.300 5.7e-03
Duchenne muscular dystrophy 1.414 7.6e-07
ependymoma 2.000 1.3e-17
gastric cancer 1.100 2.3e-03
glioblastoma 1.800 8.2e-12
group 3 medulloblastoma -1.100 1.5e-02
interstitial cystitis 1.100 9.1e-03
intraductal papillary-mucinous carcinoma... -1.600 3.0e-02
juvenile dermatomyositis 1.623 6.9e-11
lung cancer -1.800 1.0e-04
lung carcinoma -1.100 1.9e-22
Multiple myeloma 1.357 8.9e-03
ovarian cancer -1.900 1.6e-05
pancreatic cancer 2.000 3.1e-05
pancreatic carcinoma 2.000 3.1e-05
pituitary cancer -2.000 6.4e-07
primary pancreatic ductal adenocarcinoma 2.460 3.1e-04
primitive neuroectodermal tumor 1.200 1.9e-02
subependymal giant cell astrocytoma 1.710 3.7e-03
ulcerative colitis 2.900 2.3e-07
Waldenstrons macroglobulinemia 1.343 2.1e-02

 IMPC Phenotype (1)

 MGI Phenotype (1)

Gene RIF (98)

AA Sequence

MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV      1 - 70
RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE     71 - 140
VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN    141 - 210
KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI    211 - 280
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER    281 - 350
LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE    351 - 420
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA    421 - 490
SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR    491 - 560
QIRQGNTKQRIDEFESM                                                         561 - 577
//

Text Mined References (187)

PMID Year Title