Property Summary

NCBI Gene PubMed Count 270
PubMed Score 8.53
PubTator Score 571.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 4.75956834815434E-17
breast carcinoma 1614 6.98193835421945E-11
malignant mesothelioma 3163 2.39261133411236E-8
posterior fossa group A ependymoma 1511 1.05834747206836E-7
sonic hedgehog group medulloblastoma 1482 4.42264468326665E-7
pilocytic astrocytoma 3086 5.13661964043468E-7
pediatric high grade glioma 2712 1.20334436022643E-6
non-small cell lung cancer 2798 7.64667376800881E-5
glioblastoma 5572 8.92374133081964E-5
atypical teratoid/rhabdoid tumor 1095 1.63331895059106E-4
lung cancer 4473 1.85513280047327E-4
primitive neuroectodermal tumor 3031 4.58118284074916E-4
tuberculosis 1563 4.76611201620249E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.68135074461825E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00103283885469706
oligodendroglioma 2849 0.00298734162481363
pituitary cancer 1972 0.00304236502401979
acute quadriplegic myopathy 1157 0.00385580394862658
pancreatic cancer 2300 0.00513785972880369
ovarian cancer 8492 0.00808426081605628
interstitial cystitis 2299 0.0105111328375333
non diabetic and post-ischemic heart failure 200 0.0114277553356628
mucosa-associated lymphoid tissue lymphoma 480 0.0120913903343669
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0121538506848437
ulcerative colitis 2087 0.0123856251357778
cystic fibrosis 1670 0.0131865104120138
invasive ductal carcinoma 2950 0.024655528436739
Bipolar Disorder 266 0.049135774159981

Expression

Synonym

Accession P26022 B2R6T6 Q38M82
Symbols TSG-14
TNFAIP5

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (251)

PMID Text
26842615 Low plasma concentration of PTX3 in early pregnancy is associated with subsequent development of gestational diabetes and with an enhanced risk for CVD as estimated by an elevated apoB/apoA ratio at 5 years postpartum.
26738395 Data show that serum pentraxin-3, nitric oxide (NO) and and tumour necrosis factor-alpha (TNFalpha) were significantly increased in alcoholic cirrhosis patients compared to controls.
26650391 PTX3 plays a non-redundant role in resistance against microbial pathogens and in the regulation of inflammation. (Review)
26576501 data indicate TLR engagement induces PTX3 expression in microglia and the expression is detectable in multiple sclerosis(MS)lesions; enhanced PTX3 expression is expressed in microglia in preactive MS lesions and in microglia/macrophages engaged in myelin phagocytosis in actively demyelinating lesions; it was not detected in CSF of MS patients
26546709 In stroke patients without cardiovascular, cardiopulmonary and infectious diseases, serum pentraxin-3 levels are not associated with stroke prognosis.
26508705 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma
26485684 Variation in PTX3 gene expression may produce even opposite effects depending on which target organ is considered and the physiopathological context. [Review]
26457877 Studies show that pentraxin 3 (PTX3) promoter and regulatory regions were highly methylated in selected human mesenchymal and epithelial tumors, in contrast to the normal counterpart.
26434104 PTX3 may be a useful biomarker for diagnosis of febrile neutropenia in patients with lung neoplasms.
26400151 Patients with hepatocellular carcinoma had higher PTX3 plasma levels compared to individuals with mild or severe fibrosis; PTX3 rs2305619 polymorphism and plasma levels were correlated with Child-Pugh scores B and C in hepatocellular carcinoma individuals
More...

AA Sequence

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRE      1 - 70
RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ     71 - 140
RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC    141 - 210
IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL    211 - 280
TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE    281 - 350
TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS                                           351 - 381
//

Text Mined References (273)

PMID Year Title
27179743 2016 The Dual Complexity of PTX3 in Health and Disease: A Balancing Act?
26921689 2016 The pentraxins PTX3 and SAP in innate immunity, regulation of inflammation and tissue remodelling.
26842615 2016 Low circulating pentraxin 3 levels in pregnancy is associated with gestational diabetes and increased apoB/apoA ratio: a 5-year follow-up study.
26763449 2016 Mesenchymal Stromal Cell-Derived PTX3 Promotes Wound Healing via Fibrin Remodeling.
26738395 2015 Pentraxin-3 and nitric oxide as indicators of disease severity in alcoholic cirrhosis.
26650391 2016 PTX3, a humoral pattern recognition molecule at the interface between microbe and matrix recognition.
26576501 2016 Pentraxin-3 is upregulated in the central nervous system during MS and EAE, but does not modulate experimental neurological disease.
26546709 2015 Serum pentraxin-3 levels in acute stroke: No association with stroke prognosis.
26508705 2015 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma.
26485684 2015 Brain diseases and tumorigenesis: The good and bad cops of pentraxin3.
More...