Property Summary

NCBI Gene PubMed Count 270
Grant Count 15
R01 Count 7
Funding $1,328,100.89
PubMed Score 8.53
PubTator Score 571.44

Knowledge Summary


No data available


Gene RIF (251)

26842615 Low plasma concentration of PTX3 in early pregnancy is associated with subsequent development of gestational diabetes and with an enhanced risk for CVD as estimated by an elevated apoB/apoA ratio at 5 years postpartum.
26738395 Data show that serum pentraxin-3, nitric oxide (NO) and and tumour necrosis factor-alpha (TNFalpha) were significantly increased in alcoholic cirrhosis patients compared to controls.
26650391 PTX3 plays a non-redundant role in resistance against microbial pathogens and in the regulation of inflammation. (Review)
26576501 data indicate TLR engagement induces PTX3 expression in microglia and the expression is detectable in multiple sclerosis(MS)lesions; enhanced PTX3 expression is expressed in microglia in preactive MS lesions and in microglia/macrophages engaged in myelin phagocytosis in actively demyelinating lesions; it was not detected in CSF of MS patients
26546709 In stroke patients without cardiovascular, cardiopulmonary and infectious diseases, serum pentraxin-3 levels are not associated with stroke prognosis.
26508705 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma
26485684 Variation in PTX3 gene expression may produce even opposite effects depending on which target organ is considered and the physiopathological context. [Review]
26457877 Studies show that pentraxin 3 (PTX3) promoter and regulatory regions were highly methylated in selected human mesenchymal and epithelial tumors, in contrast to the normal counterpart.
26434104 PTX3 may be a useful biomarker for diagnosis of febrile neutropenia in patients with lung neoplasms.
26400151 Patients with hepatocellular carcinoma had higher PTX3 plasma levels compared to individuals with mild or severe fibrosis; PTX3 rs2305619 polymorphism and plasma levels were correlated with Child-Pugh scores B and C in hepatocellular carcinoma individuals

AA Sequence

TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS                                           351 - 381

Publication (273)

PMID Year Title
27179743 2016 The Dual Complexity of PTX3 in Health and Disease: A Balancing Act?
26921689 2016 The pentraxins PTX3 and SAP in innate immunity, regulation of inflammation and tissue remodelling.
26842615 2016 Low circulating pentraxin 3 levels in pregnancy is associated with gestational diabetes and increased apoB/apoA ratio: a 5-year follow-up study.
26763449 2016 Mesenchymal Stromal Cell-Derived PTX3 Promotes Wound Healing via Fibrin Remodeling.
26738395 2015 Pentraxin-3 and nitric oxide as indicators of disease severity in alcoholic cirrhosis.
26650391 2016 PTX3, a humoral pattern recognition molecule at the interface between microbe and matrix recognition.
26576501 2016 Pentraxin-3 is upregulated in the central nervous system during MS and EAE, but does not modulate experimental neurological disease.
26546709 2015 Serum pentraxin-3 levels in acute stroke: No association with stroke prognosis.
26508705 2015 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma.
26485684 2015 Brain diseases and tumorigenesis: The good and bad cops of pentraxin3.