Property Summary

NCBI Gene PubMed Count 308
PubMed Score 8.68
PubTator Score 571.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.247 3.9e-03
adult high grade glioma 3.900 2.8e-08
Astrocytoma, Pilocytic 2.400 5.3e-07
atypical teratoid / rhabdoid tumor 2.300 4.4e-03
Bipolar Disorder 1.571 4.9e-02
Breast cancer -4.200 4.8e-17
breast carcinoma -1.200 1.3e-03
cystic fibrosis 2.075 1.0e-06
ependymoma 3.100 6.0e-05
glioblastoma 3.700 6.8e-07
group 4 medulloblastoma 1.500 9.1e-04
interstitial cystitis 1.300 1.1e-02
intraductal papillary-mucinous adenoma (... -5.800 8.7e-04
intraductal papillary-mucinous carcinoma... -6.000 1.0e-03
intraductal papillary-mucinous neoplasm ... -5.800 1.2e-02
invasive ductal carcinoma -1.700 2.5e-02
lung cancer -2.100 6.0e-04
malignant mesothelioma -2.400 2.4e-08
mucosa-associated lymphoid tissue lympho... 1.482 1.2e-02
non diabetic and post-ischemic heart fai... -1.600 1.1e-02
non-small cell lung cancer -1.629 7.6e-05
oligodendroglioma 1.100 3.0e-03
ovarian cancer 2.100 8.1e-03
pancreatic cancer -1.600 5.1e-03
pituitary cancer -1.900 3.0e-03
primitive neuroectodermal tumor 3.100 4.6e-04
tuberculosis -2.200 4.8e-04
ulcerative colitis 1.600 1.2e-02

Synonym

Accession P26022 B2R6T6 Q38M82
Symbols TSG-14
TNFAIP5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (289)

AA Sequence

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRE      1 - 70
RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ     71 - 140
RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC    141 - 210
IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL    211 - 280
TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE    281 - 350
TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS                                           351 - 381
//

Text Mined References (311)

PMID Year Title