Property Summary

NCBI Gene PubMed Count 40
PubMed Score 21.67
PubTator Score 15.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
lung carcinoma 2844 4.89189100608343E-18
tuberculosis 1563 4.75924725445288E-11
non-small cell lung cancer 2798 2.33099464855174E-7
glioblastoma 5572 5.71340645766783E-6
pediatric high grade glioma 2712 1.76713021201506E-5
pilocytic astrocytoma 3086 2.34485859343667E-5
atypical teratoid/rhabdoid tumor 1095 3.65960884742975E-5
Breast cancer 3099 3.96529342024516E-5
psoriasis 6685 2.32389178644831E-4
lung cancer 4473 3.16710254498467E-4
cystic fibrosis 1670 0.00129976663263417
ovarian cancer 8492 0.00177016770115248
primitive neuroectodermal tumor 3031 0.003076426211665
osteosarcoma 7933 0.00428136355395105
ependymoma 2514 0.00865569034311796
colon cancer 1475 0.0132897107640879
astrocytic glioma 2241 0.0199852122455153
medulloblastoma, large-cell 6234 0.0229748287817463
oligodendroglioma 2849 0.0246877765422631
spina bifida 1064 0.0463470475619778
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0
Disease Target Count Z-score Confidence
Pulmonary valve stenosis 10 3.086 1.5

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma 1.900 0.020
ependymoma 2.200 0.009
oligodendroglioma 1.100 0.025
psoriasis -1.100 0.000
glioblastoma 2.300 0.000
osteosarcoma 3.398 0.004
cystic fibrosis 1.267 0.001
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell -2.800 0.023
primitive neuroectodermal tumor 1.400 0.003
tuberculosis -6.000 0.000
non-small cell lung cancer 1.573 0.000
colon cancer -2.100 0.013
lung cancer -1.800 0.000
pediatric high grade glioma 1.800 0.000
pilocytic astrocytoma 1.800 0.000
lung carcinoma -2.300 0.000
spina bifida -2.087 0.046
Breast cancer -2.300 0.000
ovarian cancer 1.700 0.002

Synonym

Accession P26012 A4D133 B4DHD4
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (27)

PMID Text
27157394 Integrin beta8 was differentially expressed between Fibromyalgia patients and healthy controls.
26901152 Integrins alphavbeta6 and alphavbeta8 were expressed in non-overlapping patterns by keratinocytes and maintained the epidermal residence of Langerhans cells and tissue resident memory T cells by activating latent TGF-beta.
26157134 Herpes simplex virus entry is enabled by gH/gL interaction with alphavbeta6- or alphavbeta8-integrin receptors.
25886373 Integrin Beta8 plays a role in the motility of prostate cancer cells.
25190218 overexpression of integrin alphav induces integrin alphavb8 heterodimer formation and the binding of integrin alphavbeta8 to type collagen might enhance the proliferation and invasion of SCC cells via the activation of the MEK/ERK signaling pathway.
25079481 data show that integrin beta 8, but not integrin beta 5 or integrin beta 6, protein expression is increased in liver specimens of patients with biliary atresia
24367260 alphavbeta6- and alphavbeta8-integrins acted independently and are thus interchangeable as receptors for Herpes simplex type 1 virus entry.
24294359 Brain metastases ITGB8 expression exhibits considerable heterogeneity according to tumor origin.
23874518 Desmoglein-2 co-localizes with integrin-beta8 in N-MVECs.
23283986 alphavbeta8 integrin, via interactions with RhoGDI1, regulates activation of Rho proteins to promote glioblastoma multiforme cell invasiveness.
More...

AA Sequence

MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQ      1 - 70
EDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVH     71 - 140
PLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQ    141 - 210
CSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLL    211 - 280
LVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHW    281 - 350
YKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR    351 - 420
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSK    421 - 490
CFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNL    491 - 560
CAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTC    561 - 630
YTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLK    631 - 700
VLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF     701 - 769
//

Text Mined References (41)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26901152 2016 Stromal cells control the epithelial residence of DCs and memory T cells by regulated activation of TGF-?.
26157134 2015 Dissociation of HSV gL from gH by ?v?6- or ?v?8-integrin promotes gH activation and virus entry.
25886373 2015 The tumour-promoting receptor tyrosine kinase, EphB4, regulates expression of integrin-?8 in prostate cancer cells.
25190218 2014 Overexpression of integrin ?v facilitates proliferation and invasion of oral squamous cell carcinoma cells via MEK/ERK signaling pathway that is activated by interaction of integrin ?v?8 with type ? collagen.
25079481 2014 Integrin ?-8, but not ?-5 or -6, protein expression is increased in livers of children with biliary atresia.
24367260 2013 ?v?6- and ?v?8-integrins serve as interchangeable receptors for HSV gH/gL to promote endocytosis and activation of membrane fusion.
24312400 2013 The changing integrin expression and a role for integrin ?8 in the chondrogenic differentiation of mesenchymal stem cells.
24294359 2013 Comparing the expression of integrins ?v?3, ?v?5, ?v?6, ?v?8, fibronectin and fibrinogen in human brain metastases and their corresponding primary tumors.
23874518 2013 Desmoglein-2-integrin Beta-8 interaction regulates actin assembly in endothelial cells: deregulation in systemic sclerosis.
More...