Property Summary

NCBI Gene PubMed Count 41
PubMed Score 27.70
PubTator Score 15.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.600 1.8e-03
astrocytic glioma 1.600 2.9e-02
Astrocytoma, Pilocytic 1.300 6.6e-05
atypical teratoid / rhabdoid tumor 1.200 5.0e-02
Breast cancer -2.300 4.0e-05
colon cancer -2.100 1.3e-02
cystic fibrosis 1.267 1.3e-03
ependymoma 2.000 5.6e-03
glioblastoma 1.600 6.4e-05
lung cancer -1.200 3.7e-03
lung carcinoma -2.300 4.9e-18
medulloblastoma, large-cell -2.800 2.3e-02
non-small cell lung cancer 1.375 6.3e-10
oligodendroglioma 1.100 2.5e-02
osteosarcoma 1.860 6.3e-03
ovarian cancer 1.700 1.8e-03
primitive neuroectodermal tumor 1.400 3.1e-03
psoriasis -1.100 2.3e-04
spina bifida -2.087 4.6e-02
tuberculosis -1.500 3.0e-04

Protein-protein Interaction (8)

Gene RIF (28)

AA Sequence

MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQ      1 - 70
EDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVH     71 - 140
PLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQ    141 - 210
CSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLL    211 - 280
LVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHW    281 - 350
YKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR    351 - 420
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSK    421 - 490
CFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNL    491 - 560
CAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTC    561 - 630
YTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLK    631 - 700
VLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF     701 - 769
//

Text Mined References (42)

PMID Year Title