Tclin | Integrin beta-7 |
Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT). Integrin alpha-4/beta-7 interacts with the cell surface adhesion molecules MADCAM1 which is normally expressed by the vascular endothelium of the gastrointestinal tract. Interacts also with VCAM1 and fibronectin, an extracellular matrix component. It recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Interactions involves the tripeptide L-D-T in MADCAM1, and L-D-V in fibronectin. Binds to HIV-1 gp120, thereby allowing the virus to enter GALT, which is thought to be the major trigger of AIDS disease. Interaction would involve a tripeptide L-D-I in HIV-1 gp120. Integrin alpha-E/beta-7 (HML-1) is a receptor for E-cadherin.
This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer's patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]
This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer's patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]
Comments
Disease | Target Count |
---|---|
Crohn's disease | 304 |
Multiple Sclerosis | 498 |
ulcerative colitis | 2087 |
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 2.30564103308841E-7 |
interstitial cystitis | 2299 | 0.00549443219533564 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Inflammatory bowel disease | 142 | 3.04 | 1.5 |
Multiple myeloma | 1328 | 3.028 | 1.5 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.897 | 0.000 |
interstitial cystitis | 1.200 | 0.005 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
26348893 | CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. |
26105197 | Collectively, these data suggest a role for alpha4beta7 integrin in HIV infection that is influenced by both viral and host factors including the sequence of the HIV gp120 alpha4beta7 binding motif, the cytokine milieu and bacterial vaginosis in the genital tract. |
26105197 | HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7 |
26018157 | HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7 |
25527342 | Knockdown of integrin, beta 7 (ITGB7) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells |
25265384 | HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7 |
25008916 | HIV-1 virions and many gp120s lack detectable alpha4beta7 binding activity. |
25008916 | HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7 |
24829201 | circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323. |
24802248 | Disruption of the hydrophobic contacts induces the active conformation of integrin alpha 4 beta 7. |
More... |
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFT 1 - 70 ASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL 71 - 140 QVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPS 141 - 210 KLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNV 211 - 280 SRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTS 281 - 350 AALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG 351 - 420 KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSD 421 - 490 GQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCE 491 - 560 CDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGY 561 - 630 YGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFF 631 - 700 LVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNW 701 - 770 KQDSNPLYKSAITTTINPRFQEADSPTL 771 - 798 //
PMID | Year | Title |
---|---|---|
26348893 | 2015 | Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver. |
26105197 | 2015 | South African HIV-1 subtype C transmitted variants with a specific V2 motif show higher dependence on ?4?7 for replication. |
25008916 | 2014 | Envelope glycoprotein binding to the integrin ?4?7 is not a general property of most HIV-1 strains. |
24829201 | 2014 | Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations. |
24802248 | 2014 | The hydrophobic contacts between the center of the ?I domain and the ?1/?7 helices are crucial for the low-affinity state of integrin ?4 ?7. |
24606696 | 2014 | Circulating human rotavirus specific CD4 T cells identified with a class II tetramer express the intestinal homing receptors ?4?7 and CCR9. |
24162774 | 2013 | The HIV-1 envelope protein gp120 impairs B cell proliferation by inducing TGF-?1 production and FcRL4 expression. |
23986478 | 2013 | Disruption of disulfide restriction at integrin knees induces activation and ligand-independent signaling of ????. |
23553626 | 2013 | The unique disulfide bond-stabilized W1 ?4-?1 loop in the ?4 ?-propeller domain regulates integrin ?4?7 affinity and signaling. |
23382219 | 2013 | Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins. |
More... |