Property Summary

NCBI Gene PubMed Count 65
PubMed Score 35.40
PubTator Score 20.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.897 0.000
interstitial cystitis 1.200 0.005

Synonym

Accession P26010 Q9UCP7 Q9UCS7
Symbols

Gene

PDB

2BRQ   3V4P   3V4V  

Gene RIF (62)

PMID Text
26348893 CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue.
26105197 Collectively, these data suggest a role for alpha4beta7 integrin in HIV infection that is influenced by both viral and host factors including the sequence of the HIV gp120 alpha4beta7 binding motif, the cytokine milieu and bacterial vaginosis in the genital tract.
26105197 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
26105197 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
26018157 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
25527342 Knockdown of integrin, beta 7 (ITGB7) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25265384 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
25008916 HIV-1 virions and many gp120s lack detectable alpha4beta7 binding activity.
25008916 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
25008916 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
More...

AA Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFT      1 - 70
ASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL     71 - 140
QVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPS    141 - 210
KLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNV    211 - 280
SRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTS    281 - 350
AALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG    351 - 420
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSD    421 - 490
GQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCE    491 - 560
CDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGY    561 - 630
YGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFF    631 - 700
LVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNW    701 - 770
KQDSNPLYKSAITTTINPRFQEADSPTL                                              771 - 798
//

Publication (69)

PMID Year Title
26348893 2015 Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver.
26105197 2015 South African HIV-1 subtype C transmitted variants with a specific V2 motif show higher dependence on ?4?7 for replication.
25008916 2014 Envelope glycoprotein binding to the integrin ?4?7 is not a general property of most HIV-1 strains.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24802248 2014 The hydrophobic contacts between the center of the ?I domain and the ?1/?7 helices are crucial for the low-affinity state of integrin ?4 ?7.
24606696 2014 Circulating human rotavirus specific CD4 T cells identified with a class II tetramer express the intestinal homing receptors ?4?7 and CCR9.
24162774 2013 The HIV-1 envelope protein gp120 impairs B cell proliferation by inducing TGF-?1 production and FcRL4 expression.
23986478 2013 Disruption of disulfide restriction at integrin knees induces activation and ligand-independent signaling of ????.
23553626 2013 The unique disulfide bond-stabilized W1 ?4-?1 loop in the ?4 ?-propeller domain regulates integrin ?4?7 affinity and signaling.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
More...