Property Summary

NCBI Gene PubMed Count 191
Grant Count 25
R01 Count 19
Funding $2,564,234.62
PubMed Score 98.72
PubTator Score 101.14

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (121)

PMID Text
26788840 Expression of the alpha3-Integrin splice variants in the brain
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26464707 In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis.
26418968 the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion.
26377974 Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility.
26350464 based on the interaction motifs in Sdc1 and Sdc4, called synstatins (SSTN210-240 and SSTN87-131) competitively displace the receptor tyrosine kinase and alpha3beta1 integrin from the syndecan with an IC50 of 100-300 nm
26318455 studies suggest that the presence and spacing of the RGD and synergy sites modulate integrin alpha3beta1 binding to Fn
25497870 Findings show that alpha3 integrin is essentially involved in head and neck squamous cell carcinoma (HNSCC) cell radioresistance.
25472585 ITGA3, ITGA6, ITGB3,ITGB4 and ITGB5 are associated with GC susceptibility (rs2675), ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population
25356755 our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signaling
More...

AA Sequence

MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLL      1 - 70
LAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVC     71 - 140
AHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTV    141 - 210
YFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGA    211 - 280
VFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAG    281 - 350
TSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE    351 - 420
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSC    421 - 490
VQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDN    491 - 560
LRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAA    561 - 630
FVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETI    631 - 700
FCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHR    701 - 770
LQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG    771 - 840
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAH    841 - 910
CVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDS    911 - 980
ELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDD    981 - 1050
Y//

Publication (195)

PMID Year Title
26788840 2016 Development of Splice Variant-Specific Monoclonal Antibodies Against Human ?3 Integrin.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26464707 2015 Expression of CD151/Tspan24 and integrin alpha 3 complex in aid of prognostication of HER2-negative high-grade ductal carcinoma in situ.
26418968 2015 CD151 promotes ?3?1 integrin-dependent organization of carcinoma cell junctions and restrains collective cell invasion.
26377974 2015 CD151-?3?1 integrin complexes are prognostic markers of glioblastoma and cooperate with EGFR to drive tumor cell motility and invasion.
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26318455 2015 Integrin ?3?1 Binding to Fibronectin Is Dependent on the Ninth Type III Repeat.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25497870 2015 ? integrin targeting for radiosensitization of three-dimensionally grown human head and neck squamous cell carcinoma cells.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
More...