Property Summary

NCBI Gene PubMed Count 362
Grant Count 485
R01 Count 311
Funding $44,521,232.8
PubMed Score 1960.89
PubTator Score 1533.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.700 0.000
Rheumatoid Arthritis 1.100 0.003
astrocytoma 1.400 0.000
glioblastoma 1.400 0.022
oligodendroglioma 1.300 0.000
cystic fibrosis 1.727 0.000
acute quadriplegic myopathy 1.146 0.004
adrenocortical carcinoma -1.039 0.001
primary pancreatic ductal adenocarcinoma 1.241 0.005
non-small cell lung cancer -1.226 0.000
lung cancer -4.300 0.000
colon cancer -1.500 0.013
posterior fossa group A ependymoma 1.300 0.000
subependymal giant cell astrocytoma 1.289 0.013
lung adenocarcinoma -1.400 0.000
lung carcinoma -1.800 0.000
Pick disease 1.400 0.001
acute myeloid leukemia 3.200 0.048
ovarian cancer 2.800 0.000
pancreatic cancer 1.300 0.002
dermatomyositis 1.100 0.029

Synonym

Accession P25963 B2R8L6
Symbols IKBA
MAD-3
NFKBI

Gene

PANTHER Protein Class (3)

PDB

1IKN   1NFI  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
445 confirmatory 40 / 24714 / 87312 IkB Signaling

Gene RIF (296)

PMID Text
27151455 Activated Rac1 regulates the degradation of IkappaBalpha and the nuclear translocation of STAT3-NFkappaB complexes in starved cancer cells
26691317 mutation in Chinese patient results in mycobacterial infections without ectodermal dysplasia
26647777 DAT stabilized IkBa by inhibiting the phosphorylation of Ika by the IkB kinase (IKK) complex. DAT induced proteasomal degradation of TRAF6, and DAT suppressed IKKb-phosphorylation through downregulation of TRAF6
26488500 the rs3138053 polymorphism of NFKBIA gene is a candidate for susceptibility to overall cancers, while rs696 plays a protective role [meta-analysis]
26477820 genetic variation associated with susceptibility to acute kidney injury
26446987 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26347747 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26347747 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26347747 HIV-1 Tat degrades of NFKBIA (IKappaBalpha)) in CRT-MG human astroglioma cells
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
More...

AA Sequence

MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL      1 - 70
TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR     71 - 140
DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN    141 - 210
AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML    211 - 280
PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL                                     281 - 317
//

Text Mined References (373)

PMID Year Title
27151455 2016 Activated Rac1 regulates the degradation of I?B? and the nuclear translocation of STAT3-NF?B complexes in starved cancer cells.
26691317 2016 Severe Mycobacterial Diseases in a Patient with GOF I?B? Mutation Without EDA.
26647777 2016 Diallyl trisulfide induces apoptosis by suppressing NF-?B signaling through destabilization of TRAF6 in primary effusion lymphoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26488500 2015 Common Polymorphisms in the NFKBIA Gene and Cancer Susceptibility: A Meta-Analysis.
26477820 2015 Associations between single nucleotide polymorphisms in the FAS pathway and acute kidney injury.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26252270 2015 Genetic Association Between NFKBIA -881A>G Polymorphism and Cancer Susceptibility.
26239140 2015 MicroRNA-19a mediates gastric carcinoma cell proliferation through the activation of nuclear factor-?B.
26161396 2015 Polymorphisms of NF?B1 and I?B? and Their Synergistic Effect on Nasopharyngeal Carcinoma Susceptibility.
More...