Property Summary

Ligand Count 3
NCBI Gene PubMed Count 386
PubMed Score 1979.77
PubTator Score 1533.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.700 1.4e-04
acute myeloid leukemia 2.300 9.9e-04
acute quadriplegic myopathy 1.146 3.8e-03
adrenocortical carcinoma -1.039 1.1e-03
astrocytoma 1.400 3.6e-21
colon cancer -1.500 1.3e-02
cystic fibrosis 1.727 4.8e-05
dermatomyositis 1.100 2.9e-02
glioblastoma 1.400 2.2e-02
lung adenocarcinoma -1.400 2.1e-08
lung cancer -3.600 2.0e-06
lung carcinoma -1.800 3.7e-17
non-small cell lung cancer -1.226 3.4e-14
oligodendroglioma 1.300 2.2e-13
ovarian cancer 2.800 1.4e-08
pancreatic cancer 1.300 2.3e-03
Pick disease 1.400 1.2e-03
posterior fossa group A ependymoma 1.300 1.2e-06
primary pancreatic ductal adenocarcinoma 1.241 4.8e-03
Rheumatoid arthritis 1.100 2.5e-03
subependymal giant cell astrocytoma 1.289 1.3e-02

Gene RIF (306)

AA Sequence

MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL      1 - 70
TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR     71 - 140
DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN    141 - 210
AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML    211 - 280
PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL                                     281 - 317
//

Text Mined References (397)

PMID Year Title