Property Summary

NCBI Gene PubMed Count 484
PubMed Score 3018.00
PubTator Score 2382.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
malignant mesothelioma 3163 2.79123286843635E-6
lung cancer 4473 1.56911573823026E-5
active Crohn's disease 918 9.6437086003649E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00259293804731613
osteosarcoma 7933 0.00299235833175694
active ulcerative colitis 477 0.0198863390954605
cutaneous lupus erythematosus 1056 0.0225189930545104
Disease Target Count Z-score Confidence
Graves' disease 25 0.0 5.0
Disease Target Count
Immunodeficiency with hyper-IgM 3 1

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
cutaneous lupus erythematosus 1.100 0.023
osteosarcoma -1.423 0.003
intraductal papillary-mucinous carcinoma... -1.100 0.003
lung cancer -2.300 0.000
active Crohn's disease 1.845 0.001
active ulcerative colitis 1.614 0.020

Synonym

Accession P25942 E1P5S9 Q53GN5 Q5JY15 Q5U007 Q7M4Q8 Q86YK5 Q9BYU0
Symbols p50
Bp50
CDW40
TNFRSF5

Gene

PDB

3QD6   1LB6   1CZZ   1D00   1CDF   1FLL   5DMI   5DMJ   5IHL  

  Ortholog (10)

Gene RIF (442)

PMID Text
26901523 The SNP CD40 -1C>T was associated with the IgG response against PvDBP, whereas IgG antibody titers against PvMSP-119 were influenced by the polymorphism CD86 +1057G>A.
26823861 Our findings suggest that the CD40 -1C/T SNP (rs1883832) is correlated with the susceptibility to lung cancer in Chinese, and the TT genotype may further increase the risk of lung cancer.
26821950 Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment and activation of endothelial cells, thereby promoting atherosclerosis.
26545336 CD40/CD40L system plays a role in regulating bone mineral density.
26474561 CD40 gene may play a role in the development of systemic lupus erythematosus in the Chinese population.
26462153 Study provides preliminary evidence that CD40 may stimulate tumor growth by enabling immune evasion via MDSC recruitment and inhibition of T cell expansion.
26305332 the ability of IL21 to modulate gene and miRNA expressions in CD40-activated Chronic Lymphocytic Leukemiacells, was studied.
26289938 There were significant differences in the gene and allele frequencies of CD40 gene rs1883832 C/T polymorphism between the patients with systemic lupus erythematosus and controls. sCD40 levels were increased in patients with SLE compared with controls
26268734 Studies suggest that the CD40 antigen/CD154 antigen pathway represents a promising potential therapeutic target for the prevention of transplantation rejection.
26068105 study shows a multiple sclerosis(MS)risk genotype-dependent reduction of CD40 cell-surface protein in B-lymphocytes and polarised dendritic cells; MS patients, regardless of genotype, express lower levels of CD40 cell-surface protein compared to controls in B lymphocytes; both genotype-dependent and independent downregulation of cell-surface CD40 is a feature of MS
More...

AA Sequence

MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT      1 - 70
WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSD     71 - 140
TICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILL    141 - 210
VLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ       211 - 277
//

Text Mined References (484)

PMID Year Title
26901523 2016 Polymorphisms in B Cell Co-Stimulatory Genes Are Associated with IgG Antibody Responses against Blood-Stage Proteins of Plasmodium vivax.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26823861 2015 CD40 -1C>T polymorphism and the risk of lung cancer in a Chinese population.
26821950 2016 Platelet CD40 Exacerbates Atherosclerosis by Transcellular Activation of Endothelial Cells and Leukocytes.
26545336 2016 The role of CD40 and CD40L in bone mineral density and in osteoporosis risk: A genetic and functional study.
26474561 2015 The association of CD40 polymorphisms with CD40 serum levels and risk of systemic lupus erythematosus.
26462153 2015 CD40 controls CXCR5-induced recruitment of myeloid-derived suppressor cells to gastric cancer.
26305332 2015 Interleukin 21 Controls mRNA and MicroRNA Expression in CD40-Activated Chronic Lymphocytic Leukemia Cells.
26289938 2016 Association of CD40 polymorphisms and haplotype with risk of systemic lupus erythematosus.
26268734 2015 Update on CD40 and CD154 blockade in transplant models.
More...