Property Summary

Ligand Count 2
NCBI Gene PubMed Count 510
PubMed Score 3120.26
PubTator Score 2382.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Graves' disease 24 0.0 5.0

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.845 9.6e-04
active ulcerative colitis 1.614 2.0e-02
cutaneous lupus erythematosus 1.100 2.3e-02
intraductal papillary-mucinous carcinoma... -1.100 2.6e-03
lung cancer -1.100 1.6e-02
malignant mesothelioma -2.200 2.8e-06
osteosarcoma -1.423 3.0e-03

Gene RIF (465)

AA Sequence

MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT      1 - 70
WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSD     71 - 140
TICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILL    141 - 210
VLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ       211 - 277
//

Text Mined References (511)

PMID Year Title