Property Summary

NCBI Gene PubMed Count 70
Grant Count 77
R01 Count 41
Funding $5,329,614.8
PubMed Score 177.90
PubTator Score 28.12

Knowledge Summary

Patent (6,104)

Expression

Synonym

Accession P25929 B2R6H5 NPY1-R
Symbols NPYR
NPY1-R

Gene

PANTHER Protein Class (2)

PDB

2F1U   2IIL  

  TechDev Info (1)

MLP Assay (29)

AID Type Active / Inconclusive / Inactive Description
1040 screening 1990 / 0 / 194265 Primary cell-based high-throughput screening assay for antagonists of NPY-Y1
1254 screening 252 / 0 / 943 Cell-based high-throughput confirmation assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1)
1256 screening 135 / 0 / 572 Counterscreen assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2): Cell-based high throughput assay to measure NPY-Y1 antagonism.
1277 confirmatory 14 / 0 / 49 Dose response cell-based screening assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1)
1279 confirmatory 74 / 0 / 45 Dose response counterscreen for neuropeptide Y receptor Y2 (NPY-Y2): Cell-based high throughput assay to measure NPY-Y1 antagonism
1304 screening 800 / 0 / 217317 Primary cell-based high-throughput screening assay for potentiators or agonists of NPY-Y1
1546 screening 69 / 0 / 212 Confirmation cell-based high-throughput screening assay for potentiators or agonists of NPY-Y1
1651 screening 84 / 0 / 369 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y2: Cell-based high-throughput screening assay to identify potentiators or agonists of NPY-Y1.
1697 screening 141 / 0 / 140 Fluorescence-based counterscreen assay for potentiators of NPY-Y1: cell-based high-throughput screening assay to identify agonists of NPY-Y1
1702 screening 168 / 0 / 285 Fluorescence-based counterscreen assay for potentiators of NPY-Y2: cell-based high-throughput screening assay to identify agonists of NPY-Y1.
More...

Gene RIF (45)

PMID Text
25884646 Report design of argininamide-type NPY1R antagonists.
25817573 MAPK activation by NPY Y1 receptors is an internalization-independent pathway and that this receptor can transactivate the IGFR receptor.
24779394 NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension
23838112 Y1R expression in visceral adipose tissue might be an indicator of increased risk of metabolic syndrome.
22487268 The influence of beta-arrestin adaptors and endocytosis mechanisms on plasma membrane diffusion and particle brightness of GFP-tagged neuropeptide Y (NPY) receptors, was investigated.
22309839 For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism.
21971867 Npy1 receptor transgene overexpression is associated with modest anxiolytic-like effect on mice in the open field and elevated plus maze tests.
21295110 neuropeptide Y1 and Y2 receptors were expressed in 33 percent of testicular tumors and Y1 on intratumoral blood vessels in 50 percent of testicular tumors
20837140 A C-terminal tyrosine-based motif is critical for the constitutive internalization of Y(1) receptors lacking the last 32 C-terminal amino acids.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKE      1 - 70
MRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQ     71 - 140
LIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLS    141 - 210
YTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLT    211 - 280
IFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETI    281 - 350
AMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI                                        351 - 384
//

Text Mined References (71)

PMID Year Title
25884646 2015 Toward Labeled Argininamide-Type NPY Y1 Receptor Antagonists: Identification of a Favorable Propionylation Site in BIBO3304.
25817573 2015 Neuropeptide Y receptor mediates activation of ERK1/2 via transactivation of the IGF receptor.
24779394 2014 NPY/Y? receptor-mediated vasoconstrictory and proliferative effects in pulmonary hypertension.
23838112 2013 Expressions of neuropeptide Y and Y1 receptor in subcutaneous and visceral fat tissues in normal weight and obese humans and their correlations with clinical parameters and peripheral metabolic factors.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
22626516 2012 Knockdown of a G protein-coupled receptor through efficient peptide-mediated siRNA delivery.
22487268 2012 Fluorescence correlation spectroscopy, combined with bimolecular fluorescence complementation, reveals the effects of ?-arrestin complexes and endocytic targeting on the membrane mobility of neuropeptide Y receptors.
22309839 2012 Association study of 45 candidate genes in nicotine dependence in Han Chinese.
22072432 2011 Identification of novel GH-regulated genes in C2C12 cells.
22029806 2011 Expression of Neuropeptide Y, Substance P, and their receptors in the right atrium of diabetic patients.
More...