Property Summary

NCBI Gene PubMed Count 121
Grant Count 258
R01 Count 156
Funding $25,825,457.6
PubMed Score 1148.02
PubTator Score 533.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P25874 Q13218 Q4KMZ3 Q68G66 UCP 1
Symbols UCP
SLC25A7

Gene

Gene RIF (125)

PMID Text
26959981 UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery.
26711342 In inguinal white adipose tissue (iWAT) of mice fed a high-fat diet (HFD), Ucp1 level decreases concomitantly with increases in Cnot7 and its interacting partner Tob.
26458326 UCP1 -3826 A>G polymorphism is associated with weight, body fat mass, and risk of type 2 diabetes mellitus in obese individuals candidates for bariatric surgery.
26332421 Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity
26038550 Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin.
25928572 1-3826 A>G polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population
25812254 BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians.
25644605 MED1 is required for optimal PRDM16-induced Ucp1 expression
25389910 this study reveals that human adipose-derived stromal/progenitor cells can be readily differentiated into beige adipocytes that, upon activation, undergo uncoupling protein 1-dependent thermogenesis.
25274455 This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population.
More...

AA Sequence

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEG      1 - 70
RMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVR     71 - 140
LQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILAD    141 - 210
DVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGS    211 - 280
WNVIMFVCFEQLKRELSKSRQTMDCAT                                               281 - 307
//

Text Mined References (121)

PMID Year Title
26959981 2016 UCP1 and UCP3 Expression Is Associated with Lipid and Carbohydrate Oxidation and Body Composition.
26711342 2015 Post-transcriptional Stabilization of Ucp1 mRNA Protects Mice from Diet-Induced Obesity.
26458326 2016 UCP1 -3826 A>G polymorphism affects weight, fat mass, and risk of type 2 diabetes mellitus in grade III obese patients.
26332421 2015 Sirtuin/uncoupling protein gene variants and carotid plaque area and morphology.
26038550 2015 Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin.
25928572 2015 Effect of the beta-3 adrenergic receptor Trp64Arg and uncoupling protein 1-3826 A>G genotypes on lipid and apolipoprotein levels in overweight/obese and non-obese Chinese subjects.
25812254 2015 Association of UCP1 -3826A/G and UCP3 -55C/T gene polymorphisms with obesity and its related traits among multi-ethnic Malaysians.
25644605 2015 PRDM16 enhances nuclear receptor-dependent transcription of the brown fat-specific Ucp1 gene through interactions with Mediator subunit MED1.
25389910 2015 Thermogenic activity of UCP1 in human white fat-derived beige adipocytes.
25274455 2015 The gene polymorphisms of UCP1 but not PPAR ? and TCF7L2 are associated with diabetic retinopathy in Chinese type 2 diabetes mellitus cases.
More...