Property Summary

NCBI Gene PubMed Count 137
PubMed Score 1273.24
PubTator Score 533.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Obesity 678 6.878 3.4
Cardiomyopathy, Dilated 83 0.0 0.0
Heart failure 162 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.76 2.4
Disease Target Count Z-score Confidence
Hyperglycemia 137 3.921 2.0
Lipomatosis 12 3.246 1.6

Expression

Protein-protein Interaction (1)

Gene RIF (141)

AA Sequence

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEG      1 - 70
RMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVR     71 - 140
LQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILAD    141 - 210
DVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGS    211 - 280
WNVIMFVCFEQLKRELSKSRQTMDCAT                                               281 - 307
//

Text Mined References (137)

PMID Year Title